WBSCR22 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• WBSCR22 Polyclonal antibody (28192-1-AP)

• Featured Product
• KD/KO Validated

WBSCR22 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28192-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

Bud site selection protein 23 homolog, BUD23, HASJ4442, HUSSY 3, MERM1, Metastasis-related methyltransferase 1, PP3381, Probable 18S rRNA (guanine-N(7))-methyltransferase, rRNA methyltransferase and ribosome maturation factor, WBMT, WBSCR22

• 

  WB analysis using 28192-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28192-1-AP (WBSCR22 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 28192-1-AP

  WB result of WBSCR22 antibody (28192-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-WBSCR22 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 28192-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 28192-1-AP (WBSCR22 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for WBSCR22 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28192-1-AP targets WBSCR22 in WB, IHC, IF, ELISA applications and shows reactivity with Human, Mouse samples.

• Tested Reactivity: Human, Mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28094

  Product name: Recombinant human WBSCR22 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-142 aa of BC000169

  Sequence: MASRGRRPEHGGPPELFYDETEARKYVRNSRMIDIQTRMAGRALELLYLPENKPCYLLDIGCGTGLSGSYLSDEGHYWVGLDISPAMLDEAVDREIEGDLLLGDMGQGIPFKPGTFDGCISISAVQWLCNANKKSENPAKRL

• Full Name: Williams Beuren syndrome chromosome region 22
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC000169
• Gene Symbol: WBSCR22
• Gene ID (NCBI): 114049
• RRID: AB_2918150
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43709
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

WBSCR22 (Williams-Beuren syndrome chromosomal region 22 protein), also known as BUD23, MERM1, is affected in Williams-Beuren syndrome and has been implicated in tumorigenesis and metastasis formation. WBSCR22 contains a nuclear localization signal and a common S-adenosyl-L-methionine binding motif that is evolutionarily conserved in methyltransferases (PMID: 29133897, 25525153). WBSCR22 protein is expressed at a high level in invasive breast cancer and its ectopic expression enhances tumor cell survival in the vasculature (PMID: 24086612).

Publications

What published studies show

The WBSCR22 Polyclonal antibody (Cat# 28192-1-AP) has 2 total citations. One appears in Journal of Translational Medicine (2025), studying histidine metabolism in liver cancer progression via immune microenvironment modulation through metabolic reprogramming. The other is in Heliyon (2024), investigating RNA-related DNA damage and repair, specifically the role of N7-methylguanosine in UV-exposed cell nuclei. Both citations involve human samples using WB and/or IF applications.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Transl Med; Histidine metabolism drives liver cancer progression via immune microenvironment modulation through metabolic reprogramming; Authors - Pengcheng Liu ; KD Validated
human	IF,WB	Heliyon; RNA-related DNA damage and repair: The role of N7-methylguanosine in the cell nucleus exposed to UV light; Authors - Lenka Stixová