Product Information
32315-1-PBS targets WDR17 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag36108 Product name: Recombinant human WDR17 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 130-250 aa of BC166623 Sequence: ASLSWCWNAEDVVAFVSHRGPLFIWTISGPDSGVIVHKDAHSFLSDICMFRWHTHQKGKVVFGHIDGSLSIFHPGNKNQKHVLRPESLEGTDEEDPVTALEWDPLSTDYLLVVNLHYGIRL Predict reactive species |
| Full Name | WD repeat domain 17 |
| Calculated Molecular Weight | 148 kDa |
| Observed Molecular Weight | 148 kDa |
| GenBank Accession Number | BC166623 |
| Gene Symbol | WDR17 |
| Gene ID (NCBI) | 116966 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q8IZU2 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
WD repeat-containing protein 17 (WDR17) plays a role in cell proliferation, cell cycle progression, and apoptosis, particularly in mouse spermatocyte cell lines, indicating its potential role in regulating spermatogenesis (PMID: 38791636). It is abundantly expressed in the retina and testis (PMID: 12401215).

