WDR17 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• WDR17 Polyclonal antibody, PBS Only (32315-1-PBS)

• 

  WB analysis using 32315-1-AP (same clone as 32315-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32315-1-AP (WDR17 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32315-1-PBS in a different storage buffer formulation.

WDR17 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32315-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

WD repeat-containing protein 17

---

Product Information

32315-1-PBS targets WDR17 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36108

  Product name: Recombinant human WDR17 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 130-250 aa of BC166623

  Sequence: ASLSWCWNAEDVVAFVSHRGPLFIWTISGPDSGVIVHKDAHSFLSDICMFRWHTHQKGKVVFGHIDGSLSIFHPGNKNQKHVLRPESLEGTDEEDPVTALEWDPLSTDYLLVVNLHYGIRL

• Full Name: WD repeat domain 17
• Calculated Molecular Weight: 148 kDa
• Observed Molecular Weight: 148 kDa
• GenBank Accession Number: BC166623
• Gene Symbol: WDR17
• Gene ID (NCBI): 116966
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8IZU2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

WD repeat-containing protein 17 (WDR17) plays a role in cell proliferation, cell cycle progression, and apoptosis, particularly in mouse spermatocyte cell lines, indicating its potential role in regulating spermatogenesis (PMID: 38791636). It is abundantly expressed in the retina and testis (PMID: 12401215).