WDR24 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• WDR24 Recombinant monoclonal antibody (86464-1-RR)

• 

  WB analysis using 86464-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86464-1-RR (WDR24 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 86464-1-RR

  WB result of WDR24 antibody (86464-1-RR; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-WDR24 transfected HEK-293 cells.

• 

  IP experiment of HEK-293 using 86464-1-RR

  IP result of anti-WDR24 (IP:86464-1-RR, 4ug; Detection:86464-1-RR 1:2000) with HEK-293 cells lysate 1200 ug.

• 

  Affinity and Kinetic Characterization of 86464-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86464-1-RR against Human WDR24 were performed. The affinity constant is below 1 pM.

• Featured Product
• KD/KO Validated

WDR24 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86464-1-RR

Clone No.251220G1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

C16orf21, EC:2.3.2.27, GATOR2 complex protein WDR24, JFP7, WD repeat-containing protein 24

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, HuH-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86464-1-RR targets WDR24 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag14774

  Product name: Recombinant human WDR24 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 440-790 aa of BC008025

  Sequence: LGRNQVAQTWTMLRIIYCSPGLVPTANLNHSVGKGGSCGLPLMNSFNLKDMAPGLGSETRLDRSKGDARSDTVLLDSSATLITNEDNEETEGSDVPADYLLGDVEGEEDELYLLDPEHAHPEDPECVLPQEAFPLRHEIVDTPPGPEHLQDKADSPHVSGSEADVASLAPVDSSFSLLSVSHALYDSRLPPDFFGVLVRDMLHFYAEQGDVQMAVSVLIVLGERVRKDIDEQTQEHWYTSYIDLLQRFRLWNVSNEVVKLSTSRAVSCLNQASTTLHVNCSHCKRPMSSRGWVCDRCHRCASMCAVCHHVVKGLFVWCQGCSHGGHLQHIMKWLEGSSHCPAGCGHLCEYS

• Full Name: WD repeat domain 24
• Calculated Molecular Weight: 920 aa, 102 kDa
• Observed Molecular Weight: 88 kDa
• GenBank Accession Number: BC008025
• Gene Symbol: WDR24
• Gene ID (NCBI): 84219
• RRID: AB_3744904
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96S15
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

WDR24 is a component of the GATOR2 complex which has five known subunits (WDR24, WDR59, Mios, Sec13, and Seh1L). GATOR2 complex positively regulates mTORC1 signaling by acting upstream of or in parallel to GATOR1, which is a GTPase-activating protein (GAP) for RagA or RagB and an inhibitor of the amino-acid-sensing pathway. (PMID: 23723238; 25263562)