WDR32 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• WDR32 Polyclonal antibody, PBS Only (20483-1-PBS)

• 

  WB analysis of HeLa using 20483-1-AP (same clone as 20483-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 20483-1-AP (WDR32 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20483-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 20483-1-AP (same clone as 20483-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 20483-1-AP (WDR32 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20483-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HepG2 using 20483-1-AP (same clone as 20483-1-PBS)

  IP result of anti-WDR32 (IP:20483-1-AP, 4ug; Detection:20483-1-AP 1:300) with HepG2 cells lysate 6000ug. This data was developed using the same antibody clone with 20483-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 20483-1-AP (same clone as 20483-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 20483-1-AP (WDR32 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 20483-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 20483-1-AP (same clone as 20483-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 20483-1-AP (WDR32 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 20483-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 20483-1-AP (same clone as 20483-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 20483-1-AP (WDR32 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 20483-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 20483-1-AP (same clone as 20483-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 20483-1-AP (WDR32 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 20483-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 20483-1-AP (same clone as 20483-1-PBS)

  Immunofluorescent analysis of HepG2 cells using 20483-1-AP (WDR32 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 20483-1-PBS in a different storage buffer formulation.

WDR32 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 20483-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

20483-1-PBS targets WDR32 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14360

  Product name: Recombinant human WDR32 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-225 aa of BC003520

  Sequence: TRFLMRMRLTPDCSKMLISTSSGYLLILHDLDLTNSLEVGSYPILRARRTTSSSGVSPRNSLEVVTPEVLGESDHGNCITSLQLHPKGWATLLRCSSNSDDEECTCVYEFQEGAPVRPVSPRCSLRLTHYIEEANVGRGYIKELCFSPDGRMISSPHGYGIRLLGFDKQCSELVDCLPKEASPLRVIRSLYSHNDVVLTTKFSPTHCQIASGCLSGRVSLYQPKF

• Full Name: WD repeat domain 32
• Calculated Molecular Weight: 559 aa, 61 kDa
• Observed Molecular Weight: 61 kDa
• GenBank Accession Number: BC003520
• Gene Symbol: WDR32
• Gene ID (NCBI): 79269
• RRID: AB_10695183
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5QP82
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

WDR32, containing seven WD repeats, is also termed DDB1- and CUL4-associated factor 10 (DCAF10), which may function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex (PMID: 16949367). WDR32 is able to interact with DDB1 (PMID: 16949367). WDR32 is supposed to be implicated in process of ubiquitin-dependent protein degradation system. Two isoforms are described and produced by alternative splicing. Proteintech's WDR32 antibody 20483-1-AP majorly detects WDR32 isoform1 with a theoretical MW of 61 kDa.