WDR4 Polyclonal antibody

WDR4 Polyclonal Antibody for ELISA
Cat No. 14766-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

TRM82, WD repeat containing protein 4, WD repeat domain 4, WDR4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

14766-1-AP targets WDR4 in ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6531

Product name: Recombinant human WDR4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-266 aa of BC001074

Sequence: MLLDVAVSPDDRFILTADRDEKIRVSWAAAPHSIESFCLGHTEFVSRISVVPTQPGLLLSSSGDGTLRLWEYRSGRQLHCCHLASLQELVDPQAPQKFAASRIAFWCQENCVALLCDGTSVVYIFQLDARRQQLVYRQQLAFQHQVWDVAFEETQGLWVLQDCQEAPLVLYRPVGDQWQSVPESTVLKKVSGVLRGNWAMLEGSAGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHAKKMRPGEATLSC

Predict reactive species
Full Name WD repeat domain 4
Calculated Molecular Weight 30 kDa
Observed Molecular Weight 30 kDa
GenBank Accession NumberBC001074
Gene Symbol WDR4
Gene ID (NCBI) 10785
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP57081
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

A group of functionally diverse regulatory proteins in eukaryotes, defined by a conserved core of 4 or more modular repeat units, is known as the WD repeat family. Proteins belonging to the WD repeat family are involved in a number of cellular processes, including cell cycle progression, apoptosis, signal transduction, and gene regulation. WD repeat-containing protein 4 (WDR4) belongs to the WD repeat family, and is required for the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA. It acts to stablize and induce conformation change of the catalytic subunit in the complex. There exists three isoforms, while isoform1, 2 are 45kDa band, and isoform 3 is 30 kDa band.

Loading...
||
New chat Able
正在加载,请稍候...