WDR4 Polyclonal antibody

• 

  WB analysis using 30062-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30062-1-AP (WDR4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

WDR4 Polyclonal Antibody for WB, ELISA

Cat No. 30062-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

hWH, Protein Wuho homolog, TRM82, tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4, WD repeat domain 4

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, rat kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30062-1-AP targets WDR4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30580

  Product name: Recombinant human WDR4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 128-266 aa of BC001074

  Sequence: DARRQQLVYRQQLAFQHQVWDVAFEETQGLWVLQDCQEAPLVLYRPVGDQWQSVPESTVLKKVSGVLRGNWAMLEGSAGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHAKKMRPGEATLSC

• Full Name: WD repeat domain 4
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC001074
• Gene Symbol: WDR4
• Gene ID (NCBI): 10785
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P57081
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.