WDR47 Polyclonal antibody

• 

  WB analysis using 29364-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29364-1-AP (WDR47 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

WDR47 Polyclonal Antibody for WB, ELISA

Cat No. 29364-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, ELISA

Synonyms

FLJ90135, KIAA0893, WD repeat domain 47, WDR47

---

Tested Applications

• Positive WB detected in: HeLa cells, K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29364-1-AP targets WDR47 in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30853

  Product name: Recombinant human WDR47 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 148-420 aa of BC039254

  Sequence: IPADRKLSEAGFKASNNRLFQLVMKGLLYECCVEFCQSKATGEEITESEVLLGIDLLCGNGCDDLDLSLLSWLQNLPSSVFSCAFEQKMLNIHVDKLLKPTKAAYADLLTPLISKLSPYPSSPMRRPQSADAYMTRSLNPALDGLTCGLTSHDKRISDLGNKTSPMSHSFANFHYPGVQNLSRSLMLENTECHSIYEESPERDTPVDAQRPIGSEILGQSSVSEKEPANGAQNPGPAKQEKNELRDSTEQFQEYYRQRLRYQQHLEQKEQQRQ

• Full Name: WD repeat domain 47
• Calculated Molecular Weight: 919 aa, 102 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC039254
• Gene Symbol: WDR47
• Gene ID (NCBI): 22911
• RRID: AB_2918284
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O94967
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.