WDR68 Polyclonal antibody

• 

WDR68 Polyclonal Antibody for ELISA

Cat No. 11683-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

WDR 68, WD repeat-containing protein An11 homolog, WD repeat-containing protein 68, WD repeat domain 68, DDB1- and CUL4-associated factor 7

---

Product Information

11683-1-AP targets WDR68 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2295

  Product name: Recombinant human WDR68 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-342 aa of BC001264

  Sequence: MSLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGLDEESSEFICRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMPRAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNCLEILRV

• Full Name: WD repeat domain 68
• Calculated Molecular Weight: 342 aa, 39 kDa
• GenBank Accession Number: BC001264
• Gene Symbol: WDR68
• Gene ID (NCBI): 10238
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P61962
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.