WDR74 Polyclonal antibody

• 

  WB analysis using 20631-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20631-1-AP (WDR74 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 20631-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 20631-1-AP (WDR74 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 20631-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 20631-1-AP (WDR74 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 20631-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 20631-1-AP (WDR74 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

WDR74 Polyclonal Antibody for WB, ELISA

Cat No. 20631-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

NOP seven associated protein 1, NOP seven-associated protein 1, NSA1, WD repeat domain 74, WD repeat-containing protein 74

---

Tested Applications

• Positive WB detected in: HepG2 cells, K-562 cells, MCF-7 cells, L02 cells, MDA-MB-231 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20631-1-AP targets WDR74 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14617

  Product name: Recombinant human WDR74 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-300 aa of BC006351

  Sequence: MAAAAARWNHVWVGTETGILKGVNLQRKQAANFTAGGQPRREEAVSALCWGTGGETQMLVGCADRTVKHFSTEDGIFQGQRHCPGGEGMFRGLAQADGTLITCVDSGILRVWHDKDKDTSSDPLLELRVGPGVCRMRQDPAHPHVVATGGKENALKIWDLQGSEEPVFRAKNVRNDWLDLRVPIWDQDIQFLPGSQKLVTCTGYHQVRVYDPASPQRRPVLETTYGEYPLTAMTLTPGGNSVIVGNTHGQLAEIDLRQGRLLGCLKGLAGSVRGLQCHPSKPLLASCGLDRVLRIHRIQN

• Full Name: WD repeat domain 74
• Calculated Molecular Weight: 385 aa, 42 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC006351
• Gene Symbol: WDR74
• Gene ID (NCBI): 54663
• RRID: AB_2878713
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6RFH5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

WDR74, also known as WD repeat domain 74, is a protein-coding gene that plays important roles in various biological processes. WDR74 is involved in rRNA processing and ribosomal large subunit biogenesis. It is a 60S ribosome assembly factor, which is irreplaceable in ribosome biogenesis and is closely related to protein synthesis. WDR74 can induce nuclear β-catenin accumulation and activate Wnt-responsive genes, thus promoting cell proliferation and metastasis in various cancers.