WDR82 Polyclonal antibody

• 

  WB analysis of HL-60 using 21354-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 21354-1-AP (WDR82 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 21354-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21354-1-AP (WDR82 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 21354-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21354-1-AP (WDR82 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 21354-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21354-1-AP (WDR82 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

WDR82 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 21354-1-AP

Publications(2)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

MST107, MSTP107, PRO2730, PRO34047, SWD2, TMEM113, WD repeat domain 82, WDR82, WDR82A

---

Tested Applications

• Positive WB detected in: HL-60 cells, Jurkat cells; K-562 cells
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

21354-1-AP targets WDR82 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15762

  Product name: Recombinant human WDR82 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 175-313 aa of BC018941

  Sequence: DLRSFDKGPFATFKMQYDRTCEWTGLKFSNDGKLILISTNGSFIRLIDAFKGVVMHTFGGYANSKAVTLEASFTPDSQFIMIGSEDGKIHVWNGESGIKVAVLDGKHTGPITCLQFNPKFMTFASACSNMAFWLPTIDD

• Full Name: WD repeat domain 82
• Calculated Molecular Weight: 313 aa, 35 kDa
• Observed Molecular Weight: 33-35 kDa
• GenBank Accession Number: BC018941
• Gene Symbol: WDR82
• Gene ID (NCBI): 80335
• RRID: AB_3085654
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6UXN9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Sci Adv; EIF3D safeguards the homeostasis of key signaling pathways in human primed pluripotency; Authors - Chikako Okubo
human	WB	J Exp Clin Cancer Res; Radiotherapy resistance driven by Asparagine endopeptidase through ATR pathway modulation in breast cancer; Authors - Macarena Morillo-Huesca

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Mia (Verified Customer) (07-01-2025)

This antibody was incredibly helpful for my summer project while in medical school. It was used at a 1:100 dilution for staining BHPrS1 cells, and we are planning to drop the dilution to 1:500. It was also used at a 1:200 dilution for IHC of mouse and human prostate tissue, and worked wonderfully.

• Applications: Immunohistochemistry, Immunofluorescence
• Primary Antibody Dilution: 1:200 for IHC, 1:100 for ICC
• Cell Tissue Type: Mouse & human prostate, BHPrS1 cells