WDR92 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• WDR92 Polyclonal antibody, PBS Only (25540-1-PBS)

WDR92 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 25540-1-PBS Copied!

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

DNAAF10, Dynein axonemal assembly factor 10, WD repeat domain 92, WD repeat-containing protein 92, WD repeat-containing protein Monad

• 

  WB analysis using 25540-1-AP (same clone as 25540-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 25540-1-AP (WDR92 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25540-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 25540-1-AP (same clone as 25540-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 25540-1-AP (WDR92 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 25540-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 25540-1-AP (same clone as 25540-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 25540-1-AP (WDR92 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 25540-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 25540-1-AP (same clone as 25540-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 25540-1-AP (WDR92 antibody) at dilution of 1:1200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25540-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 25540-1-AP (same clone as 25540-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 25540-1-AP (WDR92 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 25540-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 25540-1-AP (same clone as 25540-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 25540-1-AP (WDR92 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 25540-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 25540-1-AP (same clone as 25540-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 25540-1-AP (WDR92 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 25540-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 25540-1-AP (same clone as 25540-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 25540-1-AP (WDR92 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 25540-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 25540-1-AP (same clone as 25540-1-PBS)

  Immunofluorescent analysis of HepG2 cells using 25540-1-AP (WDR92 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 25540-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for WDR92 in ?

Chat with Able

---

Product Information

25540-1-PBS targets WDR92 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22181

  Product name: Recombinant human WDR92 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-357 aa of BC066657

  Sequence: MSAFEKPQIIAHIQKGFNYTVFDCKWVPCSAKFVTMGNFARGTGVIQLYEIQHGDLKLLREIEKAKPIKCGTFGATSLQQRYLATGDFGGNLHIWNLEAPEMPVYSVKGHKEIINAIDGIGGLGIGEGAPEIVTGSRDGTVKVWDPRQKDDPVANMEPVQGENKRDCWTVAFGNAYNQEERVVCAGYDNGDIKLFDLRNMALRWETNIKNGVCSLEFDRKDISMNKLVATSLEGKFHVFDMRTQHPTKGFASVSEKAHKSTVWQVRHLPQNRELFLTAGGAGGLHLWKYEYPIQRSKKDSEGIEMGVAGSVSLLQNVTLSTQPISSLDWSPDKRGLCVCSSFDQTVRVLIVTKLNKI

• Full Name: WD repeat domain 92
• Calculated Molecular Weight: 357 aa, 40 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC066657
• Gene Symbol: WDR92
• Gene ID (NCBI): 116143
• RRID: AB_2880124
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96MX6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.