WFDC12 Polyclonal antibody

• 

  IHC staining of human lung cancer using 25101-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 25101-1-AP (WFDC12 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 25101-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 25101-1-AP (WFDC12 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 25101-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 25101-1-AP (WFDC12 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 25101-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 25101-1-AP (WFDC12 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

WFDC12 Polyclonal Antibody for IHC, ELISA

Cat No. 25101-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF, IHC, ELISA

Synonyms

C20orf122, SWAM2, WAP2, WFDC12, Whey acidic protein 2

---

Tested Applications

• Positive IHC detected in: human lung cancer tissue, human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below
• IHC: See 2 publications below
• IF: See 2 publications below

Product Information

25101-1-AP targets WFDC12 in WB, IF, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18795

  Product name: Recombinant human WFDC12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 34-111 aa of BC146514

  Sequence: CPADNVRCFKSDPPQCHTDQDCLGERKCCYLHCGFKCVIPVKELEEGGNKDEDVSRPYPEPGWEAKCPGSSSTRCPQK

• Full Name: WAP four-disulfide core domain 12
• Calculated Molecular Weight: 111 aa, 12 kDa
• GenBank Accession Number: BC146514
• Gene Symbol: WFDC12
• Gene ID (NCBI): 128488
• RRID: AB_2879897
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WWY7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	J Invest Dermatol; The Whey Acidic Protein WFDC12 Is Specifically Expressed in Terminally Differentiated Keratinocytes and Regulates Epidermal Serine Protease Activity.; Authors - Polina Kalinina ; KD Validated
human	IHC,IF	Front Immunol; A role for whey acidic protein four-disulfide-core 12 (WFDC12) in the pathogenesis and development of psoriasis disease; Authors - Fulei Zhao
human	IHC	Cell Death Dis; WFDC12-overexpressing contributes to the development of atopic dermatitis via accelerating ALOX12/15 metabolism and PAF accumulation; Authors - Guolin Li