• Featured Product
  • KD/KO Validated

WFDC12 Polyclonal antibody

WFDC12 Polyclonal Antibody for IHC, ELISA
Cat No. 25101-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF, IHC, ELISA

C20orf122, SWAM2, WAP2, WFDC12, Whey acidic protein 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman lung cancer tissue, human prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

25101-1-AP targets WFDC12 in WB, IF, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18795

Product name: Recombinant human WFDC12 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 34-111 aa of BC146514

Sequence: CPADNVRCFKSDPPQCHTDQDCLGERKCCYLHCGFKCVIPVKELEEGGNKDEDVSRPYPEPGWEAKCPGSSSTRCPQK

Predict reactive species
Full Name WAP four-disulfide core domain 12
Calculated Molecular Weight 111 aa, 12 kDa
GenBank Accession NumberBC146514
Gene Symbol WFDC12
Gene ID (NCBI) 128488
RRIDAB_2879897
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8WWY7
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for WFDC12 antibody 25101-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IF

J Invest Dermatol

The Whey Acidic Protein WFDC12 Is Specifically Expressed in Terminally Differentiated Keratinocytes and Regulates Epidermal Serine Protease Activity.

Authors - Polina Kalinina
  • KD Validated
humanIHC,IF

Front Immunol

A role for whey acidic protein four-disulfide-core 12 (WFDC12) in the pathogenesis and development of psoriasis disease

Authors - Fulei Zhao
humanIHC

Cell Death Dis

WFDC12-overexpressing contributes to the development of atopic dermatitis via accelerating ALOX12/15 metabolism and PAF accumulation

Authors - Guolin Li
Loading...
||
New chat Able
正在加载,请稍候...