WNK1 Polyclonal antibody

• 

  WB analysis using 28357-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 28357-1-AP (WNK1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 28357-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 28357-1-AP (WNK1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 28357-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 28357-1-AP (WNK1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 28357-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 28357-1-AP (WNK1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

WNK1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28357-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

Human and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

Erythrocyte 65 kDa protein, HSAN2, HSN2, hWNK1, KDP, KIAA0344, Kinase deficient protein, p65, PHA2C, PRKWNK1, PSK, WNK1

---

Tested Applications

• Positive WB detected in: MCF-7 cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 5 publications below
• IF: See 1 publications below

Product Information

28357-1-AP targets WNK1 in WB, IHC, IF, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28034

  Product name: Recombinant human WNK1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-209 aa of BC021121

  Sequence: MSGGAAEKQSSTPGSLFLSPPAPAPKNGSSSDSSVGEKLGAAAADAVTGRTEEYRRRRHTMDKDSRGAAATTTTTEHRFFRRSVICDSNATALELPGLPLSLPQPSIPAAVPQSAPPEPHREETVTATATSQVAQQPPAAAAPGEQAVAGPAPSTVPSSTSKDRPVSQPSLVGSKEEPPPARSGSGGGSAKEPQEERSQQQDDIEELET

• Full Name: WNK lysine deficient protein kinase 1
• Calculated Molecular Weight: 251 kDa
• Observed Molecular Weight: 250-300 kDa
• GenBank Accession Number: BC021121
• Gene Symbol: WNK1
• Gene ID (NCBI): 65125
• RRID: AB_2881119
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H4A3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Mol Carcinog; Focal adhesion kinase confers lenvatinib resistance in hepatocellular carcinoma via the regulation of lysine-deficient kinase 1; Authors - Wei Hou ; KD Validated
human	WB	Exp Cell Res; Human adenylate kinase 6 regulates WNK1 (with no lysine kinase-1) phosphorylation states and affects ion homeostasis in NT2 cells.; Authors - Shengwei Ke
human	WB	BMC Cancer; Lymphocyte migration regulation related proteins in urine exosomes may serve as a potential biomarker for lung cancer diagnosis; Authors - Shuai Jin
human	WB	Cell Death Dis; Single-cell sequencing analysis of multiple myeloma heterogeneity and identification of new theranostic targets; Authors - Yanpeng Wang
human	WB	Front Oncol; Development of CSOARG: a single-cell and multi-omics-based machine learning model for ovarian cancer prognosis and drug response prediction; Authors - Junyu Chen