WNK1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• WNK1 Polyclonal antibody (28357-1-AP)

• Featured Product
• KD/KO Validated

WNK1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28357-1-AP Copied!

Publications (7)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

Human and More (2)

Applications

WB, IHC, IF, CoIP, ELISA

Synonyms

Erythrocyte 65 kDa protein, HSAN2, HSN2, hWNK1, KDP, KIAA0344, Kinase deficient protein, p65, PHA2C, PRKWNK1, PSK, WNK1

• 

  WB analysis using 28357-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 28357-1-AP (WNK1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 28357-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 28357-1-AP (WNK1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 28357-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 28357-1-AP (WNK1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 28357-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 28357-1-AP (WNK1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for WNK1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: MCF-7 cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28357-1-AP targets WNK1 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28034

  Product name: Recombinant human WNK1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-209 aa of BC021121

  Sequence: MSGGAAEKQSSTPGSLFLSPPAPAPKNGSSSDSSVGEKLGAAAADAVTGRTEEYRRRRHTMDKDSRGAAATTTTTEHRFFRRSVICDSNATALELPGLPLSLPQPSIPAAVPQSAPPEPHREETVTATATSQVAQQPPAAAAPGEQAVAGPAPSTVPSSTSKDRPVSQPSLVGSKEEPPPARSGSGGGSAKEPQEERSQQQDDIEELET

• Full Name: WNK lysine deficient protein kinase 1
• Calculated Molecular Weight: 251 kDa
• Observed Molecular Weight: 250-300 kDa
• GenBank Accession Number: BC021121
• Gene Symbol: WNK1
• Gene ID (NCBI): 65125
• RRID: AB_2881119
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H4A3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The anti-WNK1 antibody (Cat# 28357-1-AP) has 7 total citations published in Cell Death Dis, Eur J Pharmacol, BMC Cancer, Mol Carcinog, Exp Cell Res, Front Oncol, and Endocrine. Research fields span oncology (multiple myeloma, lung cancer, hepatocellular carcinoma, ovarian cancer), ion transport and homeostasis, and cell signaling pathways. Applications include WB, IF, and CoIP in human and rat samples.

Automatically generated from the 7 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Death Dis; Single-cell sequencing analysis of multiple myeloma heterogeneity and identification of new theranostic targets; Authors - Yanpeng Wang
rat	IF	Eur J Pharmacol; Ionic dependency, sensitivity to transport inhibitors and signal transduction of propionate-induced anion secretion in rat caecum.; Authors - Jasmin Ballout
human	WB	BMC Cancer; Lymphocyte migration regulation related proteins in urine exosomes may serve as a potential biomarker for lung cancer diagnosis; Authors - Shuai Jin
human	WB,IF	Mol Carcinog; Focal adhesion kinase confers lenvatinib resistance in hepatocellular carcinoma via the regulation of lysine-deficient kinase 1; Authors - Wei Hou ; KD Validated
human	WB	Exp Cell Res; Human adenylate kinase 6 regulates WNK1 (with no lysine kinase-1) phosphorylation states and affects ion homeostasis in NT2 cells.; Authors - Shengwei Ke
human	WB	Front Oncol; Development of CSOARG: a single-cell and multi-omics-based machine learning model for ovarian cancer prognosis and drug response prediction; Authors - Junyu Chen