WNT1 Polyclonal antibody

• 

  WB analysis using 27935-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27935-1-AP (WNT1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 27935-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27935-1-AP (WNT1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 27935-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27935-1-AP (WNT1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of NIH/3T3 using 27935-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed NIH/3T3 cells using WNT1 antibody (27935-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of HeLa using 27935-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using WNT1 antibody (27935-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

• 

  IF Staining of NIH/3T3 using 27935-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed NIH/3T3 cells using WNT1 antibody (27935-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

• 

  FC experiment of HeLa using 27935-1-AP

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human WNT1 (27935-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• Featured Product
• KD/KO Validated

WNT1 Polyclonal Antibody for WB, IF/ICC, FC (Intra), ELISA

Cat No. 27935-1-AP

Publications(56)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

INT1, Proto oncogene Int 1 homolog, Proto oncogene Wnt 1, Proto-oncogene Int-1 homolog, Proto-oncogene Wnt-1

---

Tested Applications

• Positive WB detected in: 3T3-L1 cells, HepG2 cells, NIH/3T3 cells, Jurkat cells
• Positive IF/ICC detected in: NIH/3T3 cells, HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 55 publications below
• IHC: See 7 publications below
• IF: See 3 publications below

Product Information

27935-1-AP targets WNT1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27380

  Product name: Recombinant human WNT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 228-323 aa of BC074799

  Sequence: TVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALD

• Full Name: wingless-type MMTV integration site family, member 1
• Observed Molecular Weight: 41 kDa
• GenBank Accession Number: BC074799
• Gene Symbol: WNT1
• Gene ID (NCBI): 7471
• RRID: AB_2881013
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P04628
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Wingless-related MMTV integration site 1 (Wnt1), a cysteine-rich glycosylated protein related to the Drosophila protein Wingless, has been shown to inhibit microglial inflammatory activation in a variety of CNS diseases, such as ischemic reperfusion injury in the brain, intracerebral hemorrhage, Alzheimer's disease, and Parkinson's disease (PMID: 40025242). Wnt1 is expressed in the dorsal part, and it is necessary for the maintenance of Fgf8 expression. This molecule is essential for the induction of the midbrain and the cerebellum (PMID: 34722541, PMID: 1583219). Wnt1 as a bone anabolic Wnt ligand in long bones and in alveolar bone and cementum formation during tooth maintenance (PMID: 30404864, PMID: 34009051). Wnt1 is a key regulator of neural crest cells, which constitute most of the facial mesenchymal cells (PMID:792502).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Bioengineered; MiR-130a-3p suppresses colorectal cancer growth by targeting Wnt Family Member 1 (WNT1); Authors - Guang-Lin Song
human	WB	Neural Regen Res; Genetic modification of miR-34a enhances efficacy of transplanted human dental pulp stem cells after ischemic stroke; Authors - Jianfeng Wang
human	WB	Aging (Albany NY); Exosome-mediated Hic-5 regulates proliferation and apoptosis of osteosarcoma via Wnt/β-catenin signal pathway.; Authors - Liansheng Sha
mouse	WB	J Ethnopharmacol; Mechanism of Buyang Huanwu Decoction mediating Cav1-regulated Wnt pathway to promote neural regeneration in cerebral ischemic mice; Authors - Yin OuYang
mouse	WB	Microb Biotechnol; Combination of an engineered Lactococcus lactis expressing CXCL12 with light-emitting diode yellow light as a treatment for scalded skin in mice.; Authors - Xiaoxiao Zhao
mouse	WB	Mol Neurobiol; GPR30 Inhibits Neuronal Apoptosis After Subarachnoid Hemorrhage by Activating the Wnt/β-Catenin Pathway in a m6A-dependent Manner; Authors - Jun Peng