WNT1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• WNT1 Recombinant monoclonal antibody (87881-1-RR)

• 

  WB analysis using 87881-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87881-1-RR (WNT1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of L02 using 87881-1-RR

  L02 cells were subjected to SDS PAGE followed by western blot with 87881-1-RR (WNT1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 87881-1-RR

  Biolayer interferometry (BLI) kinetic assays of 87881-1-RR against Human WNT1 were performed. The affinity constant is 4.38 nM.

WNT1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87881-1-RR

Clone No.253400F10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

INT1, Proto oncogene Int 1 homolog, Proto oncogene Wnt 1, Proto-oncogene Int-1 homolog, Proto-oncogene Wnt-1

---

Tested Applications

• Positive WB detected in: SKOV-3 cells, L02 cells, HeLa cells, Jurkat cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87881-1-RR targets WNT1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag27380

  Product name: Recombinant human WNT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 228-323 aa of BC074799

  Sequence: TVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALD

• Full Name: wingless-type MMTV integration site family, member 1
• Observed Molecular Weight: 41 kDa
• GenBank Accession Number: BC074799
• Gene Symbol: WNT1
• Gene ID (NCBI): 7471
• RRID: AB_3745806
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P04628
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Wingless-related MMTV integration site 1 (Wnt1), a cysteine-rich glycosylated protein related to the Drosophila protein Wingless, has been shown to inhibit microglial inflammatory activation in a variety of CNS diseases, such as ischemic reperfusion injury in the brain, intracerebral hemorrhage, Alzheimer's disease, and Parkinson's disease (PMID: 40025242). Wnt1 is expressed in the dorsal part, and it is necessary for the maintenance of Fgf8 expression. This molecule is essential for the induction of the midbrain and the cerebellum (PMID: 34722541, PMID: 1583219). Wnt1 as a bone anabolic Wnt ligand in long bones and in alveolar bone and cementum formation during tooth maintenance (PMID: 30404864, PMID: 34009051). Wnt1 is a key regulator of neural crest cells, which constitute most of the facial mesenchymal cells (PMID:792502).