WNT10A Polyclonal antibody

• 

  IHC staining of human oesophagus cancer using 26238-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 26238-1-AP (WNT10A Antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human oesophagus cancer using 26238-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 26238-1-AP (WNT10A Antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human oesophagus cancer using 26238-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 26238-1-AP (WNT10A Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human oesophagus cancer using 26238-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 26238-1-AP (WNT10A Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human skeletal muscle using 26238-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 26238-1-AP (WNT10A Antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human skeletal muscle using 26238-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 26238-1-AP (WNT10A Antibody) at dilution of 1:100 (under 40x lens).

• 

  IF Staining of NIH/3T3 using 26238-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed NIH/3T3 cells using 26238-1-AP (WNT10A antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of HeLa using 26238-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed HeLa cells using 26238-1-AP (WNT10A antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

WNT10A Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 26238-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

WNT10, Protein Wnt-10a, Protein Wnt 10a

---

Tested Applications

• Positive IHC detected in: human oesophagus cancer tissue, human skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: NIH/3T3 cells, HeLa cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• IHC: See 4 publications below
• IF: See 1 publications below

Product Information

26238-1-AP targets WNT10A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, goat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23963

  Product name: Recombinant human WNT10A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 154-229 aa of BC052234

  Sequence: LKACGCDASRRGDEEAFRRKLHRLQLDALQRGKGLSHGVPEHPALPTASPGLQDSWEWGGCSPDMGFGERFSKDFL

• Full Name: wingless-type MMTV integration site family, member 10A
• Calculated Molecular Weight: 417 aa, 46 kDa
• GenBank Accession Number: BC052234
• Gene Symbol: WNT10A
• Gene ID (NCBI): 80326
• RRID: AB_2880439
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9GZT5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

WNT10A is a member of the WNT gene family, which consists of structurally related genes encoding secreted signaling molecules critical for many organogenesis processes. It is strongly expressed in the cell lines of promyelocytic leukemia and Burkitt's lymphoma. In addition, it and another family member, the WNT6 gene, are strongly coexpressed in colorectal cancer cell lines.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Cancer Cell Int; Identification of the prognostic value of a 2-gene signature of the WNT gene family in UCEC using bioinformatics and real-world data.; Authors - Yuexin Hu
human	IHC	Oral Dis; Long non-coding RNAs MALAT1 and NEAT1 in non-syndromic orofacial clefts.; Authors - Errui Wang
goat	WB,IF	J Anim Sci Biotechnol; Melatonin promotes the development of the secondary hair follicles by regulating circMPP5; Authors - Xiaogao Diao
human,mouse	WB,IHC	Cancer Biother Radiopharm; Raddeanin A Inhibits Colorectal Cancer Growth and Ameliorates Oxaliplatin Resistance Through the WNT/β-Catenin Signaling Pathway; Authors - Junguo Chen ; KD Validated
mouse	IHC	Kidney Int; Non-canonical Wnt/calcium signaling is protective against podocyte injury and glomerulosclerosis; Authors - Dong Zhou
mouse	WB	Pharmacol Res; Calcaratarin D, A Labdane Diterpenoid, Attenuates Bleomycin-Induced Pulmonary Fibrosis by Blocking Wnt/β-Catenin Signaling Pathway; Authors - Wupeng Liao