WNT7A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• WNT7A Polyclonal antibody, PBS Only (27177-1-PBS)

• 

  WB analysis using 27177-1-AP (same clone as 27177-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27177-1-AP (WNT7A antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27177-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse kidney using 27177-1-AP (same clone as 27177-1-PBS)

  IP result of anti-WNT7A (IP:27177-1-AP, 4ug; Detection:27177-1-AP 1:2000) with mouse kidney tissue lysate 2160 ug. This data was developed using the same antibody clone with 27177-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 27177-1-AP (same clone as 27177-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using WNT7A antibody (27177-1-AP) at dilution of 1:600 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 27177-1-PBS in a different storage buffer formulation.

WNT7A Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 27177-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

Protein Wnt-7a, Protein Wnt 7a

---

Product Information

27177-1-PBS targets WNT7A in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26060

  Product name: Recombinant human WNT7A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 130-305 aa of BC008811

  Sequence: DCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLMNLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEPVRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQASGCD

• Full Name: wingless-type MMTV integration site family, member 7A
• Calculated Molecular Weight: 39 kDa
• Observed Molecular Weight: 30-39 kDa
• GenBank Accession Number: BC008811
• Gene Symbol: WNT7A
• Gene ID (NCBI): 7476
• RRID: AB_3085932
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00755
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

WNT7A belongs to the Wnt family. WNT7A plays an important role in embryonic development, including dorsal versus ventral patterning during limb development, skeleton development and urogenital tract development (PMID: 16826533). WNT7A is required for central nervous system (CNS) angiogenesis and blood-brain barrier regulation (PMID:30026314). WNT7A is highly expressed in basal cells and is secreted in abundance by basal cells (PMID: 36318668).