WT1 Recombinant monoclonal antibody, PBS Only

WT1 Uni-rAb® Recombinant Antibody for WB, IP, Indirect ELISA
Cat No. 82525-1-PBS
Clone No.2J13

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, Indirect ELISA

2J13, Wilms tumor 1, Wilms tumor protein

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82525-1-PBS targets WT1 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag19541

Product name: Recombinant human WT1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-302 aa of BC032861

Sequence: MEKGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQMNLGATLKGVAAGSSSSVKWTEGQSNHSTGYESDNHTTPILCGAQYRMHTHGVFRGIQDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLAL

Predict reactive species
Full Name Wilms tumor 1
Calculated Molecular Weight 449 aa, 49 kDa, 57 kDa
Observed Molecular Weight 52-55 kDa
GenBank Accession NumberBC032861
Gene Symbol WT1
Gene ID (NCBI) 7490
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP19544
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The WT1 gene encodes a zinc finger DNA-binding protein that acts as a transcriptional activator or repressor depending on the cellular or chromosomal context, and it is required for the normal formation of the genitourinary system and mesothelial tissues. WT1 inhibits apoptosis through p53 and Bcl-2 and also inhibits the differentiation of leukemic cells. The function of WT1 may be isoform-specific: isoforms lacking the KTS motif may act as transcription factors. Isoforms containing the KTS motif may bind mRNA and play a role in mRNA metabolism or splicing. Isoform 1 has a lower affinity for DNA and can bind RNA. WT1 exists some isoforms with a range of molecular weight is 33-50 kDa.

Loading...
||
New chat Able
正在加载,请稍候...