FRMD6/Willin Polyclonal antibody

FRMD6/Willin Polyclonal Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 21039-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), ELISA

FRMD6, Willin, EX1, FERM domain containing 6, FERM domain-containing protein 6

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inU2OS cells
Positive IHC detected inhuman liver cancer tissue, human liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
Immunohistochemistry (IHC)IHC : 1:20-1:200
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IHCSee 1 publications below

Product Information

21039-1-AP targets FRMD6/Willin in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag15375

Product name: Recombinant human Willin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-266 aa of BC029870

Sequence: LDMDQLEKRSRASGSSAGSMKHKRLSRHSTASHSSSHTSGIEADTKPRDTGPEDSYSSSAIHRKLKTCSSMTSHGSSHTSGVESGGKDRLEEDLQDDEIEMLVDDPRDLEQMNEESLEVSPDMCIYITEDMLMSRKLNGHSGLIVKEIGSSTSSSSETVVKLRGQSTDSLPQTICRKPKTSTDRHSLSLDDIRLYQKDFLRIAGLCQDTAQSYTFGCGHELDEEGLYCNSCLAQQCINIQDAFPVKRTSKYFSLDLTHDEVPEFVV

Predict reactive species
Full Name FERM domain containing 6
Calculated Molecular Weight 622 aa, 72 kDa
Observed Molecular Weight72, 70, 30 kDa
GenBank Accession NumberBC029870
Gene Symbol FRMD6/Willin
Gene ID (NCBI) 122786
RRIDAB_2878797
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96NE9
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Willin, also known as FRMD6 or human Expanded (hEx), is a member of the FERM-domain family of cytoskeletal crosslinkers. It is a potent inhibitor of cell proliferation, transformation and modulator of drug sensitivity, suggesting it possesses tumor suppressor properties. Willin is widely expressed in normal tissues. Although willin is found in the cytoplasm and membrane, it localizes to the nuclei of almost all tumors.This antibody was raised against the C-terminal region of human FRMD6 protein and is expected to recognize the endogenous FRMD6.

Protocols

Product Specific Protocols
FC protocol for FRMD6/Willin antibody 21039-1-APDownload protocol
IHC protocol for FRMD6/Willin antibody 21039-1-APDownload protocol
WB protocol for FRMD6/Willin antibody 21039-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

BMC Cancer

TP53 mutation status and consensus molecular subtypes of colorectal cancer in patients from Rwanda

Authors - Augustin Nzitakera
Loading...
||
New chat Able
正在加载,请稍候...