XAF1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• XAF1 Polyclonal antibody (27057-1-AP)

• 

  WB analysis using 27057-1-AP

  Untreated and IFN alpha treated treated Jurkat cells were subjected to SDS PAGE followed by western blot with 27057-1-AP (XAF1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 27057-1-AP

  Untreated and IFN alpha treated treated Jurkat cells were subjected to SDS PAGE followed by western blot with 27057-1-AP (XAF1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of Jurkat using 27057-1-AP

  IP result of anti-XAF1 (IP:27057-1-AP, 4ug; Detection:27057-1-AP 1:800) with Jurkat cells lysate 1920 ug.

XAF1 Polyclonal Antibody for WB, IP, ELISA

Cat No. 27057-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, ELISA

Synonyms

BIRC4 binding protein, BIRC4-binding protein, BIRC4BP, XIAP associated factor 1, XIAPAF1

---

Tested Applications

• Positive WB detected in: Jurkat cells, IFN alpha treated treated Jurkat cells
• Positive IP detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27057-1-AP targets XAF1 in WB, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25843

  Product name: Recombinant human XAF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 254-301 aa of BC073156

  Sequence: PRGDKAAYDILRRCSQCGILLPLPILNQHQEKCRWLASSKGKQVRNFS

• Full Name: XIAP associated factor 1
• Calculated Molecular Weight: 301 aa, 35 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC073156
• Gene Symbol: XAF1
• Gene ID (NCBI): 54739
• RRID: AB_3742214
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6GPH4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

XIAP-associated factor 1 (XAF1) is also named as BIRC4BP (BIRC4-binding protein) and XIAPAF1. XAF1 was originally identified as an antagonist of XIAP counteracting its anti-caspase activity by inhibiting the RING domain of XIAP. XAF1is also concerned with IFN-induced apoptosis (PMID: 35972291). XAF1 plays a key role in the communication between IRF1-mediated early immune responses and IRF3-mediated late IFN-dependent immune responses (PMID: 37595039). XAF1 as a direct interacting protein of AKT1, which strongly binds the N-terminal region of AKT1 to block its K63-linked poly-ubiquitination and subsequent activation (PMID: 37384528). XAF1 may serve as an osteoprotective regulator to restore bone homeostasis (PMID: 38957269).