Tested Applications
| Positive WB detected in | Jurkat cells, IFN alpha treated treated Jurkat cells |
| Positive IP detected in | Jurkat cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27057-1-AP targets XAF1 in WB, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25843 Product name: Recombinant human XAF1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 254-301 aa of BC073156 Sequence: PRGDKAAYDILRRCSQCGILLPLPILNQHQEKCRWLASSKGKQVRNFS Predict reactive species |
| Full Name | XIAP associated factor 1 |
| Calculated Molecular Weight | 301 aa, 35 kDa |
| Observed Molecular Weight | 35 kDa |
| GenBank Accession Number | BC073156 |
| Gene Symbol | XAF1 |
| Gene ID (NCBI) | 54739 |
| RRID | AB_3742214 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6GPH4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
XIAP-associated factor 1 (XAF1) is also named as BIRC4BP (BIRC4-binding protein) and XIAPAF1. XAF1 was originally identified as an antagonist of XIAP counteracting its anti-caspase activity by inhibiting the RING domain of XIAP. XAF1is also concerned with IFN-induced apoptosis (PMID: 35972291). XAF1 plays a key role in the communication between IRF1-mediated early immune responses and IRF3-mediated late IFN-dependent immune responses (PMID: 37595039). XAF1 as a direct interacting protein of AKT1, which strongly binds the N-terminal region of AKT1 to block its K63-linked poly-ubiquitination and subsequent activation (PMID: 37384528). XAF1 may serve as an osteoprotective regulator to restore bone homeostasis (PMID: 38957269).
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for XAF1 antibody 27057-1-AP | Download protocol |
| WB protocol for XAF1 antibody 27057-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The XAF1 Polyclonal antibody (Cat# 27057-1-AP) has 1 total citation. It appears in Biochemical Pharmacology (Impact Factor 6.5), in a study investigating how gamabufotalin impedes non-small cell lung cancer (NSCLC) progression by inhibiting the mitochondrial factor CHCHD2 and modulating XAF1 expression. The research field encompasses oncology, specifically NSCLC, and mitochondrial biology, with the antibody used in Western blot applications on human samples.
| Species | Application | Title |
|---|---|---|
Biochem Pharmacol Gamabufotalin impedes NSCLC progression by inhibiting the mitochondrial factor CHCHD2 and modulating XAF1 expression. |
