XBP1 Fusion Protein

Source

e coli.-derived, PET28a

Tag

6*His

Format

Liquid

Cat no : Ag21714

Synonyms

TREB5; XBP2



Product Information

Peptide Sequence LRLRAPLQQVQAQLSPLQNISPWILAVLTLQIQSLISCWAFWTTWTQSCSSNALPQSLPAWRSSQRSTQKDPVPYQPPFLCQWGRHQPSWKPLMN
(167-261 aa encoded by BC000938)
Activity Not tested.
Endotoxin Level Please contact the lab for more information.
Formulation The protein was expressed as 6xHis-tagged fusion protein by E.Coli and purified by Ni-sepharose. The purified protein was resolved in PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4 ) added with 15% glycerol. The elution buffer contain 300mM imidazole.