XCL1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of NK-92 using 86437-1-RR (same clone as 86437-1-PBS)

  PMA, Ionomycin and Brefeldin A treated NK-92 cells were subjected to SDS PAGE followed by western blot with 86437-1-RR (XCL1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86437-1-PBS in a different storage buffer formulation.

XCL1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86437-1-PBS

Clone No.250232D1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Lymphotactin, ATAC, C motif chemokine 1, Cytokine SCM-1, SCM-1-alpha

---

Product Information

86437-1-PBS targets XCL1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2933

  Product name: Recombinant Human XCL1 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 22-114 aa of NM_002995.2

  Sequence: VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG

• Full Name: chemokine (C motif) ligand 1
• Calculated Molecular Weight: 13 kDa
• Observed Molecular Weight: 11 kDa
• GenBank Accession Number: NM_002995.2
• Gene Symbol: XCL1
• Gene ID (NCBI): 6375
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P47992
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

XCL1 also known as Lymphotactin, is a member of the chemokine superfamily. Chemokines function in inflammatory and immunological responses, inducing leukocyte migration and activation.