Home
Products
Primary Antibodies
XK Polyclonal antibody, PBS Only (12830-1-PBS)

Filter: AllWBIHC

WB analysis of mouse pancreas using 12830-1-AP (same clone as 12830-1-PBS)
mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 12830-1-AP (XK Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12830-1-PBS in a different storage buffer formulation.
WB analysis of MCF-7 using 12830-1-AP (same clone as 12830-1-PBS)
MCF-7 cells were subjected to SDS PAGE followed by western blot with 12830-1-AP (XK Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12830-1-PBS in a different storage buffer formulation.
IHC staining of human pancreas cancer using 12830-1-AP (same clone as 12830-1-PBS)
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 12830-1-AP (XK Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 12830-1-PBS in a different storage buffer formulation.
IHC staining of human pancreas cancer using 12830-1-AP (same clone as 12830-1-PBS)
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 12830-1-AP (XK Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 12830-1-PBS in a different storage buffer formulation.
IHC staining of Human Colon cancer using 12830-1-AP (same clone as 12830-1-PBS)
Immunohistochemical analysis of paraffin-embedded Human Colon cancer tissue slide using 12830-1-AP (XK antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12830-1-PBS in a different storage buffer formulation.

XK Polyclonal antibody, PBS Only

Name: XK Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 12830-1-PBS

XK Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 12830-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

12830-1-PBS targets XK in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag3550 Product name: Recombinant human XK protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 371-444 aa of BC036019 Sequence: QFFHPCKKLFSSSVSEGFQRWLRCFCWACRQQKPCEPIGKEDLQSSRDRDETPSSSKTSPEPGQFLNAEDLCSA Predict reactive species
Full Name	X-linked Kx blood group (McLeod syndrome)
Calculated Molecular Weight	444 aa, 51 kDa
Observed Molecular Weight	45-51 kDa
GenBank Accession Number	BC036019
Gene Symbol	XK
Gene ID (NCBI)	7504
RRID	AB_2877887
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P51811
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

XK, also named as XKR1 and XRG1, is responsible for the Kx blood group system. XK forms a functional complex with the Kell glycoprotein. It represents a crucial factor for the maintenance of normal muscle structure and function.