XKR6 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• XKR6 Polyclonal antibody (23968-1-AP)

XKR6 Polyclonal Antibody for WB, ELISA

Cat No. 23968-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

C8orf21, C8orf5, C8orf7, XK related protein 6, XK-related protein 6

• 

  WB analysis of Jurkat using 23968-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 23968-1-AP (XKR6 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Y79 using 23968-1-AP

  Y79 cells were subjected to SDS PAGE followed by western blot with 23968-1-AP (XKR6 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 23968-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 23968-1-AP (XKR6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for XKR6 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells, HeLa cells, Y79 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

23968-1-AP targets XKR6 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21104

  Product name: Recombinant human XKR6 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 491-641 aa of BC024146

  Sequence: MLLYYGVLHPTGPRAKILASSCCAELLWGIPLPPDVEPMAPEIPGYRGTQVTPTRAVTEQQEDLTADTCLPVFQVRPMGPPTPLGRPYLPEGPLIKIDMPRKRYPAWDAHFVDRRLRRTINILQYVTPTAVGIRYRDGPLLYELLQYESSL

• Full Name: XK, Kell blood group complex subunit-related family, member 6
• Calculated Molecular Weight: 362aa,42 kDa; 641aa,72 kDa
• Observed Molecular Weight: 41-45 kDa
• GenBank Accession Number: BC024146
• Gene Symbol: XKR6
• Gene ID (NCBI): 286046
• RRID: AB_2879381
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q5GH73
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The XKR6 Polyclonal antibody (Cat# 23968-1-AP) has 1 total citation. It appears in Frontiers in Oncology (2025), where it was used for IHC to study the genetic landscape of primary malignant melanoma of the cervix through integrated bioinformatics and whole-exome sequencing. The research field is oncology, specifically cervical melanoma genomics.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Front Oncol; The genetic landscape of primary malignant melanoma of the cervix using integrated bioinformatics analysis and whole-exome sequencing.; Authors - Jialiu Zhou