XKR6 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• XKR6 Polyclonal antibody (23968-1-AP)

• 

  WB analysis of Jurkat using 23968-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 23968-1-AP (XKR6 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 23968-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 23968-1-AP (XKR6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Y79 using 23968-1-AP

  Y79 cells were subjected to SDS PAGE followed by western blot with 23968-1-AP (XKR6 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

XKR6 Polyclonal Antibody for WB, ELISA

Cat No. 23968-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

C8orf21, C8orf5, C8orf7, XK related protein 6, XKR6, XRG6

---

Tested Applications

• Positive WB detected in: Jurkat cells, HeLa cells, Y79 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below

Product Information

23968-1-AP targets XKR6 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21104

  Product name: Recombinant human XKR6 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 491-641 aa of BC024146

  Sequence: MLLYYGVLHPTGPRAKILASSCCAELLWGIPLPPDVEPMAPEIPGYRGTQVTPTRAVTEQQEDLTADTCLPVFQVRPMGPPTPLGRPYLPEGPLIKIDMPRKRYPAWDAHFVDRRLRRTINILQYVTPTAVGIRYRDGPLLYELLQYESSL

• Full Name: XK, Kell blood group complex subunit-related family, member 6
• Calculated Molecular Weight: 362aa,42 kDa; 641aa,72 kDa
• Observed Molecular Weight: 41-45 kDa
• GenBank Accession Number: BC024146
• Gene Symbol: XKR6
• Gene ID (NCBI): 286046
• RRID: AB_2879381
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q5GH73
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Front Oncol; The genetic landscape of primary malignant melanoma of the cervix using integrated bioinformatics analysis and whole-exome sequencing.; Authors - Jialiu Zhou