XPO7 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• XPO7 Polyclonal antibody (12980-1-AP)

• Featured Product
• KD/KO Validated

XPO7 Polyclonal Antibody for WB, ELISA

Cat No. 12980-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, ELISA

Synonyms

Exp7, exportin 7, Exportin-7, KIAA0745, Ran binding protein 16

• 

  WB analysis of K-562 using 12980-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 12980-1-AP (XPO7 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 12980-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12980-1-AP (XPO7 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 12980-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 12980-1-AP (XPO7 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse spleen using 12980-1-AP

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 12980-1-AP (XPO7 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for XPO7 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse spleen tissue, K-562 cells, human brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12980-1-AP targets XPO7 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3603

  Product name: Recombinant human XPO7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-300 aa of BC030785

  Sequence: MADHVQSLAQLENLCKQLYETTDTTTRLQAEKALVEFTNSPDCLSKCQLLLERGSSSYSQLLAATCLTKLVSRTNNPLPLEQRIDIRNYVLNYLATRPKLATFVTQALIQLYARITKLGWFDCQKDDYVFRNAITDVTRFLQDSVEYCIIGVTILSQLTNEINQADTTHPLTKHRKIASSFRDSSLFDIFTLSCNLLKQASGKNLNLNDESQHGLLMQLLKLTHNCLNFDFIGTSTDESSDDLCTVQIPTSWRSAFLDSSTLQLFFDLYHSIPPSFSPLVLSCLVQIASVRRSLFNNAER

• Full Name: exportin 7
• Calculated Molecular Weight: 1087 aa, 124 kDa
• Observed Molecular Weight: 100-110 kDa
• GenBank Accession Number: BC030785
• Gene Symbol: XPO7
• Gene ID (NCBI): 23039
• RRID: AB_2215493
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UIA9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The XPO7 polyclonal antibody (Cat# 12980-1-AP) has 4 citations. These appear in Neuron, Frontiers in Immunology, Scientific Reports, and the Journal of Cellular Biochemistry. Research fields span neurodegeneration (ALS/Frontotemporal Dementia), virology (HIV-2 Vpx/NF-κB), and osteoarthritis (exosomal XPO7/chondrocyte senescence).

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Neuron; Inhibition of RNA splicing triggers CHMP7 nuclear entry, impacting TDP-43 function and leading to the onset of ALS cellular phenotypes; Authors - Norah Al-Azzam
human	WB	Front Immunol; A Mass Spectrometry-Based Profiling of Interactomes of Viral DDB1- and Cullin Ubiquitin Ligase-Binding Proteins Reveals NF-κB Inhibitory Activity of the HIV-2-Encoded Vpx.; Authors - Christine D Landsberg
human	WB,IF	Sci Rep; TDP43 nuclear export and neurodegeneration in models of amyotrophic lateral sclerosis and frontotemporal dementia.; Authors - Hilary C Archbold ; KD Validated
		J Cell Biochem; BMSCs-Derived Exosomal XPO7 Attenuates Osteoarthritis Progression by Targeting KDM2B to Ameliorate Chondrocyte Senescence.; Authors - Xiaodong Mao