XRN2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• XRN2 Polyclonal antibody (11267-1-AP)

• Featured Product
• KD/KO Validated

XRN2 Polyclonal Antibody for WB, ELISA

Cat No. 11267-1-AP Copied!

Publications (11)

Reviews (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, IP, CoIP, ChIP, ELISA

Synonyms

5 3 exoribonuclease 2, 5' 3' exoribonuclease 2, 5'-3' exoribonuclease 2, DHM1 like protein, DHM1-like protein

• 

  WB analysis using 11267-1-AP

  HEK-293T cells were subjected to SDS PAGE followed by western blot with 11267-1-AP (XRN2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 11267-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 11267-1-AP (XRN2 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of COLO 320 using 11267-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 11267-1-AP (XRN2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 11267-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11267-1-AP (XRN2 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for XRN2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293T cells, COLO 320 cells, HEK-293 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11267-1-AP targets XRN2 in WB, IHC, IF, IP, CoIP, ChIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1788

  Product name: Recombinant human XRN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 651-950 aa of BC006417

  Sequence: PFVDERRLRAALEEVYPDLTPEETRRNSLGGDVLFVGKHHPLHDFILELYQTGSTEPVEVPPELCHGIQGKFSLDEEAILPDQIVCSPVPMLRDLTQNTVVSINFKDPQFAEDYIFKAVMLPGARKPAAVLKPSDWEKSSNGRQWKPQLGFNRDRRPVHLDQAAFRTLGHVMPRGSGTGIYSNAAPPPVTYQGNLYRPLLRGQAQIPKLMSNMRPQDSWRGPPPLFQQQRFDRGVGAEPLLPWNRMLQTQNAAFQPNQYQMLAGPGGYPPRRDDRGGRQGYPREGRKYPLPPPSGRYNWN

• Full Name: 5'-3' exoribonuclease 2
• Calculated Molecular Weight: 104 kDa
• Observed Molecular Weight: 104 kDa
• GenBank Accession Number: BC006417
• Gene Symbol: XRN2
• Gene ID (NCBI): 22803
• RRID: AB_2288787
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H0D6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

XRN2 is one exonuclease that degrades the Pol II associated product of poly(A) site cleavage, which is crucial for Pol II termination. During transcription termination, XRN2 cleavages at the polyadenylation site liberates a 5' fragment which is subsequently processed to form the mature mRNA and a 3' fragment which remains attached to the elongating polymerase. The processive degradation of this 3' fragment by this protein may promote termination of transcription.

Publications

What published studies show

The XRN2 Polyclonal antibody (Cat# 11267-1-AP) has 11 citations spanning journals including Nature, Cell, Nature Communications, Molecular Cell, EMBO Journal, Journal of Cell Biology, PLoS Pathogens, Journal of Virology, and Methods in Molecular Biology. Research fields covered include transcription termination, RNA processing, tRNA acetylation, R-loop biology, m6A modification, RNA:DNA hybrid resolution, HCV replication, nuclear speckle function, astrocyte reactivity, and the integrated stress response.

Automatically generated from the 11 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Nature; Divergent transcriptional regulation of astrocyte reactivity across disorders.; Authors - Joshua E Burda
human	WB	Cell; Microprocessor, Setx, Xrn2, and Rrp6 co-operate to induce premature termination of transcription by RNAPII.; Authors - Wagschal Alexandre A ; KD Validated
human	WB	Cell; Integrator loss leads to dsRNA formation that triggers the integrated stress response; Authors - Apoorva Baluapuri
mouse	WB	Nat Commun; Mammalian tRNA acetylation determines translation efficiency and tRNA quality control.; Authors - Na Liu
human	WB	Mol Cell; DDX21 mediates co-transcriptional RNA m6A modification to promote transcription termination and genome stability; Authors - Jin-Dong Hao
		Mol Cell; RNA exonuclease REXO4 resolves m(6)A-marked R-loops and suppresses anti-tumor immunity.; Authors - Jieyou Zhang

Reviews

5.0 out of 5

3 verified customer reviews

What customers say

All three reviewers gave this antibody a 5-star rating for Western Blot. Users reported successful and specific detection of Xrn2 in HEK293T, RKO, and U2OS cells. Recommended dilutions ranged from 1:2000 to 1:3000, with one user noting overnight incubation at 4°C. Overall, customers found the antibody to work well and produce clear, specific results across multiple human cell lines.

Automatically generated from the 3 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Moritz (Verified Customer) (09-24-2025)

I used this antibody to detect Xrn2 in human HEK293T cells and it worked well

• Applications: Western Blot
• Primary Antibody Dilution: 1:3000
• Cell Tissue Type: HEK293T

XRN2 Antibody Western Blot validation (1:3000 dilution) in HEK293T (Cat no:11267-1-AP)

Aleksandr (Verified Customer) (07-19-2025)

Specific detection of Xrn2 in RKO cells. Antibody were incubated at 4C overnight

• Applications: Western Blot
• Primary Antibody Dilution: 1:2000
• Cell Tissue Type: RKO

XRN2 Antibody Western Blot validation (1:2000 dilution) in RKO (Cat no:11267-1-AP)

Tsimafei (Verified Customer) (11-19-2024)

Great antibody!

• Applications: Western Blot
• Primary Antibody Dilution: 1:3000
• Cell Tissue Type: U2OS

XRN2 Antibody Western Blot validation (1:3000 dilution) in U2OS (Cat no:11267-1-AP)