YAF2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• YAF2 Polyclonal antibody, PBS Only (13980-1-PBS)

• 

  WB analysis of HEK-293 using 13980-1-AP (same clone as 13980-1-PBS)

  WB result of YAF2 antibody (13980-1-AP; 1:400; incubated at room temperature for 1.5 hours) with sh-Control and sh-YAF2 transfected HEK-293 cells. This data was developed using the same antibody clone with 13980-1-PBS in a different storage buffer formulation.

• 

  IP experiment of Jurkat using 13980-1-AP (same clone as 13980-1-PBS)

  IP result of anti-YAF2 (IP:13980-1-AP, 4ug; Detection:13980-1-AP 1:800) with Jurkat cells lysate 1920 ug. This data was developed using the same antibody clone with 13980-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 13980-1-AP (same clone as 13980-1-PBS)

  IP result of anti-YAF2 (IP:13980-1-AP, 4ug; Detection:13980-1-AP 1:600) with HeLa cells lysate 1760 ug. This data was developed using the same antibody clone with 13980-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 13980-1-AP (same clone as 13980-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13980-1-AP (YAF2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13980-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 13980-1-AP (same clone as 13980-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13980-1-AP (YAF2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13980-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 13980-1-AP (same clone as 13980-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using YAF2 antibody (13980-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red). This data was developed using the same antibody clone with 13980-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 13980-1-AP (same clone as 13980-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using YAF2 antibody (13980-1-AP) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red). This data was developed using the same antibody clone with 13980-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

YAF2 Polyclonal Antibody for IHC, IF/ICC, IP, Indirect ELISA

Cat No. 13980-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, IP, Indirect ELISA

Synonyms

YY1 associated factor 2, YY1-associated factor 2

---

Product Information

13980-1-PBS targets YAF2 in IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5023

  Product name: Recombinant human YAF2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-204 aa of BC037777

  Sequence: MGDKKSPTRPKRQPKPSSDEGYWDCSVCTFRNSAEAFKCMMCDVRKGTSTRSTLFEVIVSASRTKEPLKFPISGRKPRPVSQLVAQQVTQQFVPPTQSKKEKKDKVEKEKSEKETTSKKNSHKKTRPRLKNVDRSSAQHLEVTVGDLTVIITDFKEKTKSPPASSAASADQHSQSGSSSDNTERGMSRSSSPRGEASSLNGESH

• Full Name: YY1 associated factor 2
• Calculated Molecular Weight: 204 aa, 23 kDa
• Observed Molecular Weight: 20-30 kDa
• GenBank Accession Number: BC037777
• Gene Symbol: YAF2
• Gene ID (NCBI): 10138
• RRID: AB_3669173
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IY57
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

YY1-associated factor 2 (YAF2) is the binding molecule of Yin-Yang-1 (YY-1) protein and plays an important role in transcriptional regulation. YAF-2 mRNA expression was the highest in heart and skeletal muscle (PMID: 11953439).