YAP1 Recombinant monoclonal antibody, PBS Only

• 

YAP1 antibodies are used to detect Yes-associated protein 1, a critical effector in the Hippo pathway, in studies of cell proliferation, organ size regulation, and cancer. Proteintech has an extensive range of YAP1 antibodies validated for WB, IHC, IF/ICC, IF-P, FC (Intra) IP, ELISA and more.

Cat No. 81087-1-PBS

Clone No.5H2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA

Synonyms

65 kDa Yes associated protein, Protein yorkie homolog, Transcriptional coactivator YAP1, YAP, yes associated protein 1

---

Product Information

81087-1-PBS targets YAP1 in Sandwich ELISA, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Affinity:
  K_D=1.01 x 10^-10M
  K_Off=4.24 x 10^-5M
  K_On=4.18 x 10^5M
• Immunogen:

  CatNo: Ag4510

  Product name: Recombinant human YAP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 155-504 aa of BC038235

  Sequence: PTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL

• Full Name: Yes-associated protein 1, 65kDa
• Calculated Molecular Weight: 504 aa, 54 kDa
• GenBank Accession Number: BC038235
• Gene Symbol: YAP1
• Gene ID (NCBI): 10413
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P46937
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.