YAP1 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA standard curve of MP00309-1

  Sandwich ELISA standard curve of MP00309-1, YAP1 Recombinant Matched Antibody Pair - PBS only. Capture antibody: 81096-1-PBS. Detection antibody: 81099-1-PBS. Standard: Ag4510. Range: 78.1-5000 pg/mL.

YAP1 antibodies are used to detect Yes-associated protein 1, a critical effector in the Hippo pathway, in studies of cell proliferation, organ size regulation, and cancer. Proteintech has an extensive range of YAP1 antibodies validated for WB, IHC, IF/ICC, IF-P, FC (Intra) IP, ELISA and more.

Cat No. 81096-1-PBS

Clone No.1M10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

65 kDa Yes associated protein, Protein yorkie homolog, Transcriptional coactivator YAP1, YAP, yes associated protein 1

---

Product Information

81096-1-PBS targets YAP1 as part of a matched antibody pair:

MP00309-1: 81096-1-PBS capture and 81099-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Affinity:
  K_D=1.37 x 10^-10M
  K_Off=1.08 x 10^-4M
  K_On=7.87 x 10^5M
• Immunogen:

  CatNo: Ag4510

  Product name: Recombinant human YAP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 155-504 aa of BC038235

  Sequence: PTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL

• Full Name: Yes-associated protein 1, 65kDa
• Calculated Molecular Weight: 504 aa, 54 kDa
• GenBank Accession Number: BC038235
• Gene Symbol: YAP1
• Gene ID (NCBI): 10413
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P46937
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.