YAP1 Recombinant monoclonal antibody, PBS Only (Capture)

YAP1 antibodies are used to detect Yes-associated protein 1, a critical effector in the Hippo pathway, in studies of cell proliferation, organ size regulation, and cancer. Proteintech has an extensive range of YAP1 antibodies validated for WB, IHC, IF/ICC, IF-P, FC (Intra) IP, ELISA and more.
Cat No. 81096-1-PBS
Clone No.1M10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA, Sample test

65 kDa Yes associated protein, Protein yorkie homolog, Transcriptional coactivator YAP1, YAP, yes associated protein 1

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

81096-1-PBS targets YAP1 as part of a matched antibody pair:

MP00309-1: 81096-1-PBS capture and 81099-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Affinity
KD=1.37 x 10-10M
KOff=1.08 x 10-4M
KOn=7.87 x 105M
Immunogen

CatNo: Ag4510

Product name: Recombinant human YAP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 155-504 aa of BC038235

Sequence: PTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL

Predict reactive species
Full Name Yes-associated protein 1, 65kDa
Calculated Molecular Weight 504 aa, 54 kDa
GenBank Accession NumberBC038235
Gene Symbol YAP1
Gene ID (NCBI) 10413
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP46937
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...