YIPF7 Polyclonal antibody

YIPF7 Polyclonal Antibody for IHC, ELISA
Cat No. 21347-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, ELISA

YIP1B, YIP1 family member 7, Yip1 domain family, member 7, Protein YIPF7, Five-pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 9

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inmouse brain tissue, mouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21347-1-AP targets YIPF7 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag15695

Product name: Recombinant human YIPF7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-110 aa of BC103996

Sequence: MDLLKISHTKLHLLEDLSIKNKQRMSNLAQFDSDFYQSNFTIDNQEQSGNDSNAYGNLYGSRKQQAGEQPQPASFVPSEMLMSSGYAGQFFQPASNSDYYSQSPYIDSFD

Predict reactive species
Full Name Yip1 domain family, member 7
Calculated Molecular Weight 280 aa, 31 kDa
GenBank Accession NumberBC103996
Gene Symbol YIPF7
Gene ID (NCBI) 285525
RRIDAB_10734323
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8N8F6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

YIPF7, or Yip1 domain family, member 7, is a protein that is part of the YIPF protein family. It is involved in regulating membrane dynamics and may play a role in disease pathways.

Protocols

Product Specific Protocols
IHC protocol for YIPF7 antibody 21347-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...