Tested Applications
| Positive IHC detected in | human endometrial cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15403-1-AP targets YPEL3 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7626 Product name: Recombinant human YPEL3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-119 aa of BC005009 Sequence: MVRISKPKTFQAYLDDCHRRYSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD Predict reactive species |
| Full Name | yippee-like 3 (Drosophila) |
| Calculated Molecular Weight | 14 kDa |
| Observed Molecular Weight | 14 kDa |
| GenBank Accession Number | BC005009 |
| Gene Symbol | YPEL3 |
| Gene ID (NCBI) | 83719 |
| RRID | AB_11042587 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P61236 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
YPEL3 is part of a five-member family of closely related paralogues: YPEL1-5, which are named in reference to their Drosophila ortholgue. Studies showed shat YPEL3 is regulated by p53 and its encoding protein induces cellular senescence in human tumor and normal cells, indicating that YPEL3 is a p53-dependent, tumor suppressor gene. (PMID:20388804) 15403-1-AP was raised against full length of YPEL3 protein (1-119aa); it can recognize YPEL1-4.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for YPEL3 antibody 15403-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Int J Cancer Novel senescence associated gene, YPEL3, is repressed by estrogen in ER+ mammary tumor cells and required for tamoxifen-induced cellular senescence. | ||
Sci Rep Steroid sulfatase deficiency causes cellular senescence and abnormal differentiation by inducing Yippee-like 3 expression in human keratinocytes. | ||
Front Genet Identification of a cellular senescence-related-lncRNA (SRlncRNA) signature to predict the overall survival of glioma patients and the tumor immune microenvironment |



