YSK4 Polyclonal antibody

YSK4 Polyclonal Antibody for ELISA
Cat No. 17350-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

RCK, YSK4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

17350-1-AP targets YSK4 in ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag11423

Product name: Recombinant human YSK4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1140-1307 aa of BC034417

Sequence: MEFVPGGSISSIINRFGPLPEMVFCKYTKQILQGVAYLHENCVVHRDIKGNNVMLMPTGIIKLIDFGCARRLAWAGLNGTHSDMLKSMHGTPYWMAPEVINESGYGRKSDIWSIGCTVFEMATGKPPLASMDRMAAMFYIGAHRGLMPPLPDHFSENAADFVRMCLTR

Predict reactive species
Full Name YSK4 Sps1/Ste20-related kinase homolog (S. cerevisiae)
Calculated Molecular Weight1328aa,150 kDa; 168aa,19 kDa
GenBank Accession NumberBC034417
Gene Symbol YSK4
Gene ID (NCBI) 80122
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ56UN5
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.
Loading...
||
New chat Able
正在加载,请稍候...