YWHAB Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• YWHAB Polyclonal antibody, PBS Only (10936-1-PBS)

• 

  IHC staining of human colon cancer using 10936-1-AP (same clone as 10936-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10936-1-AP (YWHAB antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10936-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 10936-1-AP (same clone as 10936-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10936-1-AP (YWHAB antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10936-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 10936-1-AP (same clone as 10936-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10936-1-AP (YWHAB antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10936-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 10936-1-AP (same clone as 10936-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10936-1-AP (YWHAB antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10936-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 10936-1-AP (same clone as 10936-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HepG2 cells using YWHAB antibody (10936-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 10936-1-PBS in a different storage buffer formulation.

YWHAB Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 10936-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

10936-1-PBS targets YWHAB in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1383

  Product name: Recombinant human YWHAB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-63 aa of BC010352

  Sequence: MNDLICFLDNTFKNNVLSQAWWCVHLVPTIWEAEAGGSLEPRSLKLQCPVVAPVNNCTPAWAT

• Full Name: tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide
• Calculated Molecular Weight: 28 kDa
• GenBank Accession Number: BC010352
• Gene Symbol: YWHAB
• Gene ID (NCBI): 7529
• RRID: AB_2217489
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P31946
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

YWHAB (also known as 14-3-3 beta) is a member of 14-3-3 proteins which were the first phosphoserine/phosphothreonine-binding proteins to be discovered. 14-3-3 family members interact with a wide spectrum of proteins and possess diverse functions. Mammals express seven distinct 14-3-3 isoforms (gamma, epsilon, beta, zeta, sigma, theta, tau) that form multiple homo- and hetero- dimmers. 14-3-3 proteins display the highest expression levels in the brain, and have been implicated in several neurodegenerative diseases, including Alzheimer's disease and amyotrophic lateral sclerosis. This antibody was raised agaist the N-terminal region of human YWHAB.