Tested Applications
| Positive WB detected in | HeLa cells, Jurkat cells, MDA-MB-231 cells |
| Positive IHC detected in | human colon cancer tissue, human ovary cancer tissue, rat tongue tissue, mouse tongue tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28761-1-AP targets ZAK in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30599 Product name: Recombinant human ZAK protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 223-325 aa of BC001401 Sequence: ERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNKAEWRCEIEATLERLKKLERDLSFKEQELKERERRLKMWEQKLTEQ Predict reactive species |
| Full Name | sterile alpha motif and leucine zipper containing kinase AZK |
| Calculated Molecular Weight | 91 kDa |
| Observed Molecular Weight | 91kDa, 51 kDa |
| GenBank Accession Number | BC001401 |
| Gene Symbol | ZAK |
| Gene ID (NCBI) | 51776 |
| RRID | AB_2918199 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NYL2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ZAK(sterile-alpha motif and leucine zipper containing kinase AZK) is also named as MLTK, MAPKKK, mlklak, MLK7, AZK, MLT, MRK, HCCS-4, MAP3K20 and belongs to the MAPKKK family. It is a mitogen-activated protein kinase kinase kinase (MAP3K) that activates the stress-activated protein kinase/c-jun N-terminal kinase pathway and activates NF-kappaB. ZAK contributes to regulation of DNA damage checkpoints through a p38gamma-independent pathway. This protein has 3 isoforms produced by alternative splicing with the MW of 91 kDa, 51 kDa and 35 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ZAK antibody 28761-1-AP | Download protocol |
| IHC protocol for ZAK antibody 28761-1-AP | Download protocol |
| WB protocol for ZAK antibody 28761-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ZAK Polyclonal antibody (Cat# 28761-1-AP) has 8 citations published in Metabolism, Genome Biology, Leukemia, International Immunopharmacology, Inflammation, Journal of Cellular and Molecular Medicine, FEBS Journal, and Animals. Research fields span hepatic metabolic stress, CRISPR-Cas13d lethality, chronic myeloid leukemia, ulcerative colitis, colitis-associated pyroptosis, renal autophagy, viral translational stress, and oxidative stress in chicken hepatocytes. Applications cited include WB and IF across human, mouse, and chicken species.
| Species | Application | Title |
|---|---|---|
Metabolism Glutamine synthetase deficiency triggers mitochondrial oxidative stress and a ribotoxic stress response during acute hepatic metabolic crisis. | ||
Genome Biol The collateral activity of RfxCas13d can induce lethality in a RfxCas13d knock-in mouse model
| ||
Leukemia BCR::ABL1 tyrosine kinase inhibitors induce ribosome collisions to activate ZAK-dependent ribotoxic stress and apoptosis in chronic myeloid leukemia.
| ||
Int Immunopharmacol Inhibition the MAP3K20-mediated ribotoxic stress response pathway downregulates M1 macrophage polarization in ulcerative colitis. | ||
Inflammation ZAKα Induces Pyroptosis of Colonic Epithelium Via the Caspase-11/GSDMD Pathway to Aggravate Colitis | ||
J Cell Mol Med Linoleic Acid Enhances Renal Tubular Epithelial Cells Autophagy Caused by Calcium Oxalate Monohydrate Crystals |
Reviews
What customers say
Both reviewers rated the antibody 5 stars for Western Blot. One user confirmed reliable performance on A549 cells at a 1:800 dilution. The other reported excellent results on mouse skeletal muscle and liver lysates at 1:5000, noting clear detection of both alpha and beta isoforms as expected. Overall, the antibody demonstrates strong specificity and sensitivity across cell lines and tissue lysates in WB applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Luca (Verified Customer) (10-06-2026) | tested for Western Blot on A549 cells
|
Troy (Verified Customer) (10-02-2025) | Western on mouse skeletal muscle and liver lysates was superb. Detected alpha and beta isoforms in skeletal muscle and liver as expected
|
