ZBED1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ZBED1 Polyclonal antibody (26140-1-AP)

ZBED1 Polyclonal Antibody for WB, ELISA

Cat No. 26140-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

ALTE, DREF, dREF homolog, hDREF, KIAA0785, TRAMP, ZBED1

• 

  WB analysis using 26140-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26140-1-AP (ZBED1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse heart using 26140-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 26140-1-AP (ZBED1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ZBED1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse heart tissue, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26140-1-AP targets ZBED1 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23578

  Product name: Recombinant human ZBED1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 343-694 aa of BC015030

  Sequence: HCMLVSNRVSWWGSTLAMLQRLKEQQFVIAGVLVEDSNNHHLMLEASEWATIEGLVELLQPFKQVAEMLSASRYPTISMVKPLLHMLLNTTLNIKETDSKELSMAKEVIAKELSKTYQETPEIDMFLNVATFLDPRYKRLPFLSAFERQQVENRVVEEAKGLLDKVKDGGYRPAEDKIFPVPEEPPVKKLMRTSTPPPASVINNMLAEIFCQTGGVEDQEEWHAQVVEELSNFKSQKVLGLNEDPLKWWSDRLALFPLLPKVLQKYWCVTATRVAPERLFGSAANVVSAKRNRLAPAHVDEQVFLYENARSGAEAEPEDQDEGEWGLDQEQVFSLGDGVSGGFFGIRDSSFL

• Full Name: zinc finger, BED-type containing 1
• Observed Molecular Weight: 78 kDa
• GenBank Accession Number: BC015030
• Gene Symbol: ZBED1
• Gene ID (NCBI): 9189
• RRID: AB_2880398
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O96006
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The ZBED1 Polyclonal antibody (Cat# 26140-1-AP) has 2 total citations. These appear in Nature Communications (IF 18.1) and International Journal of Biological Macromolecules (IF 8.7). The cited research spans two fields: ubiquitin-mediated protein degradation (combinatorial ubiquitin code and deubiquitylation-protected substrates) and ovarian cancer biomarker discovery (prognostic protein signatures involving AQP5 and CTDP1). Both studies used the antibody for Western blot in human samples.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; Combinatorial ubiquitin code degrades deubiquitylation-protected substrates; Authors - Mai Morita
human	WB	Int J Biol Macromol; Development of novel prognostic protein signatures in ovarian cancer: Molecular structure and immune function of AQP5 protein and CTDP1 protein; Authors - Xin Ning