ZBTB10 Polyclonal antibody

• 

  WB analysis of A375 using 22944-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 22944-1-AP (ZBTB10 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse liver using 22944-1-AP

  IP result of anti-ZBTB10 (IP:22944-1-AP, 3ug; Detection:22944-1-AP 1:1000) with mouse liver tissue lysate 12500ug.

• 

  IP experiment using 22944-1-AP

  IP result of ZBTB10 antibody (22944-1-AP for IP and Detection) with mouse liver tissue lysate.

ZBTB10 Polyclonal Antibody for WB, IP, ELISA

Cat No. 22944-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, ELISA

Synonyms

RINZF, RINZFC, ZBTB10, Zinc finger protein RIN ZF

---

Tested Applications

• Positive WB detected in: A375 cells
• Positive IP detected in: mouse liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

22944-1-AP targets ZBTB10 in WB, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19094

  Product name: Recombinant human ZBTB10 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 299-519 aa of BC127098

  Sequence: PESVVVDYNNRKPVNRDGLSSSRDQKIASFWATRNLTNLASNVKIENDGCNVDEGQIENYQMNDSSWVQDGSPEMAENESEGQTKVFIWNNMGSQGIQETGKTRRKNQTTKRFIYNIPPNNETNLEDCSVMQPPVAYPEENTLLIKEEPDLDGALLSGPDGDRNVNANLLAEAGTSQDGGDAGTSHDFKYGLMPGPSNDFKYGLIPGTSNDFKYGLIPGAS

• Full Name: zinc finger and BTB domain containing 10
• Calculated Molecular Weight: 871 aa, 95 kDa
• Observed Molecular Weight: 65 kDa, 130 kDa
• GenBank Accession Number: BC127098
• Gene Symbol: ZBTB10
• Gene ID (NCBI): 65986
• RRID: AB_2879188
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q96DT7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Zinc finger and BTB domain-containing protein 10 (ZBTB10), also known as RINZF, RINZFC, May be involved in transcriptional regulation. Multiple isoforms of ZBTB10 exist due to alternative splicing events.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	BMC Gastroenterol; ZBTB10 as a potential prognosis biomarker and correlates with the tumor immune microenvironment in stomach adenocarcinoma; Authors - Yingdi Jiang