ZBTB17 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ZBTB17 Polyclonal antibody (22691-1-AP)

• 

  WB analysis using 22691-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22691-1-AP (ZBTB17 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 22691-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22691-1-AP (ZBTB17 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

ZBTB17 Polyclonal Antibody for WB, ELISA

Cat No. 22691-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

Synonyms

MIZ 1, MIZ1, pHZ 67, Zinc finger protein 151, Zinc finger protein 60

---

Tested Applications

• Positive WB detected in: Jurkat cells, THP-1 cells, NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22691-1-AP targets ZBTB17 in applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18396

  Product name: Recombinant human ZBTB17 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 454-803 aa of BC126163

  Sequence: KFNQVGNLKAHLKIHIADGPLKCRECGKQFTTSGNLKRHLRIHSGEKPYVCIHCQRQFADPGALQRHVRIHTGEKPCQCVMCGKAFTQASSLIAHVRQHTGEKPYVCERCGKRFVQSSQLANHIRHHDNIRPHKCSVCSKAFVNVGDLSKHIIIHTGEKPYLCDKCGRGFNRVDNLRSHVKTVHQGKAGIKILEPEEGSEVSVVTVDDMVTLATEALAATAVTQLTVVPVGAAVTADETEVLKAEISKAVKQVQEEDPNTHILYACDSCGDKFLDANSLAQHVRIHTAQALVMFQTDADFYQQYGPGGTWPAGQVLQAGELVFRPRDGAEGQPALAETSPTAPECPPPAE

• Full Name: zinc finger and BTB domain containing 17
• Calculated Molecular Weight: 803 aa, 88 kDa
• Observed Molecular Weight: 88-100 kDa
• GenBank Accession Number: BC126163
• Gene Symbol: ZBTB17
• Gene ID (NCBI): 7709
• RRID: AB_3742078
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q13105
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZBTB17 (zinc finger and BTB domain protein 17), also known as MIZ1, is a highly conserved transcription factor in evolution. It is expressed in many cell types and plays an important role in many biological processes such as cell cycle regulation, immune cell development and metabolic regulation. ZBTB17 plays a key role in the early stage of T cell development. It ensures the normal development of T cells by regulating the expression of pre-TCR and inhibiting the activity of TP53. ZBTB17 plays an important role in cardiac stress response, and its absence may lead to cardiomyopathy and heart failure. At Lys-397 and Lys-481, it undergoes "Lys-48" linked ubiquitination, and then degrades proteasome in a TRAF2-dependent manner.