Use Able AI chat for product recommendations

ZBTB48 Recombinant monoclonal antibody

ZBTB48 Uni-rAb® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 86981-1-RR
Clone No.252100C1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

TZAP, HKR3, Krueppel-related zinc finger protein 3, pp9964, Protein HKR3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

86981-1-RR targets ZBTB48 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag20301

Product name: Recombinant human ZBTB48 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-293 aa of BC013573

Sequence: MDGSFVQHSVRVLQELNKQREKGQYCDATLDVGGLVFKAHWSVLACCSHFFQSLYGDGSGGSVVLPAGFAEIFGLLLDFFYTGHLALTSGNRDQVLLAARELRVPEAVELCQSFKPKTSVGQAAGGQSGLGPPASQNVNSHVKEPAGLEEEEVSRTLGLVPRDQEPRGSHSPQRPQLHSPAQSEGPSSLCGKLKQALKPCPLEDKKPEDCKVPPRPLEAEGAQLQGGSNEWEVVVQVEDDGDGDYMSEPEAVLTRRKSNVIRKPCAAEPALSAGSLAAEPAENRKGTAVPVEC

Predict reactive species
Full Name zinc finger and BTB domain containing 48
Calculated Molecular Weight 688 aa, 77 kDa
Observed Molecular Weight 77 kDa
GenBank Accession NumberBC013573
Gene Symbol ZBTB48
Gene ID (NCBI) 3104
RRIDAB_3745253
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP10074
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZBTB48, also named as TZAP and HKR3, is a 688 amino acid protein, which contains 1 BTB (POZ) domain and 11 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. ZBTB48 is detected in adrenal gland and neuroblastoma. ZBTB48 binds to and regulates the J and/or S elements in MHC II promoter. Zinc finger and BTB domain containing 48 (ZBTB48), also known as telomeric zinc-finger associated protein (TZAP), is a protein that triggers the trimming of telomeres in the absence of shelterin. ZBTB48, is a relatively uncharacterized POK family protein with a POZ-domain and 11 zinc finger domains. ZBTB48, is ubiquitously expressed in human tissues. The ZBTB48 gene is mapped to human chromosome 1p36, which is commonly rearranged (leiomyoma and leukemias) or deleted in various cancers (neuroblastoma, melanoma, Merkel cell carcinomas, pheochromocytoma and breast and colon carcinomas. A correlation between deletions or rearrangements of HKR3 and human cancer suggest a role for ZBTB48 as a potential tumor suppressor.

Protocols

Product Specific Protocols
IF protocol for ZBTB48 antibody 86981-1-RRDownload protocol
WB protocol for ZBTB48 antibody 86981-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...