ZBTB7A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZBTB7A Polyclonal antibody, PBS Only (30658-1-PBS)

• 

  WB analysis using 30658-1-AP (same clone as 30658-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30658-1-AP (ZBTB7A antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30658-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 30658-1-AP (same clone as 30658-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30658-1-AP (ZBTB7A antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30658-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 30658-1-AP (same clone as 30658-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 30658-1-AP (ZBTB7A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30658-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 30658-1-AP (same clone as 30658-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 30658-1-AP (ZBTB7A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30658-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 30658-1-AP (same clone as 30658-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using ZBTB7A antibody (30658-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red). This data was developed using the same antibody clone with 30658-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 30658-1-AP (same clone as 30658-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using ZBTB7A antibody (30658-1-AP) at dilution of 1:600 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red). This data was developed using the same antibody clone with 30658-1-PBS in a different storage buffer formulation.

ZBTB7A Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 30658-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Factor binding IST protein 1, FBI 1, FBI1, FBI-1, HIV 1 1st binding protein 1

---

Product Information

30658-1-PBS targets ZBTB7A in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31077

  Product name: Recombinant human ZBTB7A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 459-584 aa of NM_015898

  Sequence: VHTGLRPYQCDSCCKTFVRSDHLHRHLKKDGCNGVPSRRGRKPRVRGGAPDPSPGATATPGAPAQPSSPDARRNGQEKHFKDEDEDEDVASPDGLGRLNVAGAGGGGDSGGGPGAATDGNFTAGLA

• Full Name: zinc finger and BTB domain containing 7A
• Calculated Molecular Weight: 61 kDa
• Observed Molecular Weight: 61-70 kDa
• GenBank Accession Number: NM_015898
• Gene Symbol: ZBTB7A
• Gene ID (NCBI): 51341
• RRID: AB_3669747
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95365
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZBTB7A, also named as LRF, FBI1, FBI-1, pokemon, ZBTB7, ZNF857A and DKFZp547O146, a member of the POK (POZ and Krüppel) family of transcription factors, plays a role in differentiation, oncogenesis, and adipogenesis (PMID: 35798238). ZBTB7A is involved in the instruction of early lymphoid progenitors to develop into B lineage by repressing T-cell instructive Notch signals. ZBTB7A is widely expressed in normal thymus and it is aberrantly overexpressed in human cancers (PMID: 28942243). ZBTB7A has 10 potential sumoylation sites located at lysine 61, 354, 371, 379, 383, 396, 486, 487, 536 and 539 (PMID: 20471975, 19471103). ZBTB7A has a predicted molecular weight of 61 kDa.