ZBTB7B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZBTB7B Polyclonal antibody, PBS Only (11341-1-PBS)

• 

  WB analysis using 11341-1-AP (same clone as 11341-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11341-1-AP (ZBTB7B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11341-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 11341-1-AP (same clone as 11341-1-PBS)

  IP result of anti-ZBTB7B (IP:11341-1-AP, 4ug; Detection:11341-1-AP 1:3000) with HeLa cells lysate 1320 ug. This data was developed using the same antibody clone with 11341-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 11341-1-AP (same clone as 11341-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using ZBTB7B antibody (11341-1-AP) at dilution of 1:1600 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 11341-1-PBS in a different storage buffer formulation.

ZBTB7B Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 11341-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

11341-1-PBS targets ZBTB7B in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1888

  Product name: Recombinant human ZBTB7B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-300 aa of BC012070

  Sequence: MGSPEDDLIGIPFPDHSSELLSCLNEQRQLGHLCDLTIRTQGLEYRTHRAVLAACSHYFKKLFTEGGGGAVMGAGGSGTATGGAGAGVCELDFVGPEALGALLEFAYTATLTTSSANMPAVLQAARLLEIPCVIAACMEILQGSGLEAPSPDEDDCERARQYLEAFATATASGVPNGEDSPPQVPLPPPPPPPPRPVARRSRKPRKAFLQTKGARANHLVPEVPTVPAHPLTYEEEEVAGRVGSSGGSGPGDSYSPPTGTASPPEGPQSYEPYEGEEEEEELVYPPAYGLAQGGGPPLSP

• Full Name: zinc finger and BTB domain containing 7B
• Calculated Molecular Weight: 539 aa, 58 kDa
• Observed Molecular Weight: 60-65 kDa
• GenBank Accession Number: BC012070
• Gene Symbol: ZBTB7B
• Gene ID (NCBI): 51043
• RRID: AB_2217245
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15156
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZBTB7B belongs to a large family of transcription factors, generally acting as repressors, characterized by a carboxy-terminal DNA binding domain made of multiple zinc fingers (four in Thpok) and an amino-terminal BTB-POZ domain that mediates homo- (and possibly hetero-) dimerization [PMID: 17084908]. Zbtb7b is up-regulated by MHC-II-restricted thymocytes during their CD4 differentiation and is a major determinant of CD4 lineage choice. Two properties of ZBTB7B deserve attention. First, although Thpok is expressed in a wide variety of cells, its expression in the thymus is highly lineage-specific : CD4 SP thymocytes (and all CD4 T cells) express Thpok, whereas DP and CD8 SP thymocytes do notSecond, both loss- and gain-of-function experiments indicate that Thpok affects lineage choice but not positive selection [PMID: 15729333, 10550051].