Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

ZC3H12D Polyclonal antibody

ZC3H12D Polyclonal Antibody for WB, IHC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IP, ELISA

MCPIP4, MCP-induced protein 4, MCP induced protein 4, FLJ46041, EC:3.1.-.-

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for ZC3H12D in ?

Tested Applications

Positive WB detected inRaji cells, K-562 cells
Positive IP detected inRaji cells
Positive IHC detected inhuman tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

24991-1-AP targets ZC3H12D in WB, IHC, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag21770

Product name: Recombinant human ZC3H12D protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-90 aa of BC157832

Sequence: MEHPSKMEFFQKLGYDREDVLRVLGKLGEGALVNDVLQELIRTGSRPGALEHPAAPRLVPRGSCGVPDSAQRGPGTALEEDFRTLASSLR

Predict reactive species
Full Name zinc finger CCCH-type containing 12D
Calculated Molecular Weight 527 aa, 58 kDa
Observed Molecular Weight 55-58 kDa
GenBank Accession NumberBC157832
Gene Symbol ZC3H12D
Gene ID (NCBI) 340152
RRIDAB_2879834
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDA2A288
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZC3H12D, also named as MCP induced protein 4, is a 527 amino acid protein, which contains one C3H1-type zinc finger and belongs to the ZC3H12 family. ZC3H12D exists as three isoforms and localizes in the cytoplasm. ZC3H12D may regulate cell growth likely by suppressing RB1 phosphorylation and serves as a tumor suppressor in certain leukemia cells. ZC3H12D is expressed in normal human lymphocytes but defective in some leukemia/lymphoma cell lines.

Protocols

Product Specific Protocols
IHC protocol for ZC3H12D antibody 24991-1-APDownload protocol
IP protocol for ZC3H12D antibody 24991-1-APDownload protocol
WB protocol for ZC3H12D antibody 24991-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The ZC3H12D antibody (Cat# 24991-1-AP) has 7 citations published in Nature Communications, Cell Reports Medicine, Frontiers in Aging Neuroscience, Computational and Structural Biotechnology Journal, Journal of Biological Chemistry, Oncology Letters, and Translational Cancer Research. Research fields span extracellular mRNA nuclear transport, biliary tract cancer organoids, leukoaraiosis/inflammation, MALT1 substrate prediction, IL-6 mRNA degradation, osteosarcoma, and lung adenocarcinoma biomarkers.

SpeciesApplicationTitle
WB

Nat Commun

Extracellular mRNA transported to the nucleus exerts translation-independent function.

Authors - Takeshi Tomita
  • KO Validated
humanIHC

Cell Rep Med

Personalized drug screening in patient-derived organoids of biliary tract cancer and its clinical application

Authors - Xiaoxue Ren
humanWB

Front Aging Neurosci

DNA Methylation Profiling Reveals the Change of Inflammation-Associated ZC3H12D in Leukoaraiosis.

Authors - Wen-Qing Huang
humanWB

Comput Struct Biotechnol J

Integrating knowledge of protein sequence with protein function for the prediction and validation of new MALT1 substrates

Authors - Peter A Bell
mouseWB

J Biol Chem

Monocyte Chemotactic Protein-induced Protein 1 and 4 Form a Complex but Act Independently in Regulation of Interleukin-6 mRNA Degradation.

Authors - Shengping Huang
  • KD Validated
humanIHC

Transl Cancer Res

ZC3H12D is a prognostic biomarker associated with immune cell infiltration in lung adenocarcinoma.

Authors - Wangang Gong

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

One reviewer (Elaine Wong) gave a 5-star rating after using the antibody at 1:1000 in 5% BSA+TBS-T for Western Blot on murine T cells. She reported a single clear band at the expected size with no apparent cross-reactivity to Zc3h12a, describing the performance as very good overall.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Elaine (Verified Customer) (09-06-2024)

Worked very nicely in western blot. Showed one clear band of the correct size in mouse T cell lysate and appears to not have cross-reactivity with Zc3h12a.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000 in 5% BSA+TBS-T
  • Cell Tissue Type: murine T cells
Loading...
||
New chat

Able™

正在加载,请稍候...