Tested Applications
| Positive WB detected in | Raji cells, K-562 cells |
| Positive IP detected in | Raji cells |
| Positive IHC detected in | human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24991-1-AP targets ZC3H12D in WB, IHC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21770 Product name: Recombinant human ZC3H12D protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-90 aa of BC157832 Sequence: MEHPSKMEFFQKLGYDREDVLRVLGKLGEGALVNDVLQELIRTGSRPGALEHPAAPRLVPRGSCGVPDSAQRGPGTALEEDFRTLASSLR Predict reactive species |
| Full Name | zinc finger CCCH-type containing 12D |
| Calculated Molecular Weight | 527 aa, 58 kDa |
| Observed Molecular Weight | 55-58 kDa |
| GenBank Accession Number | BC157832 |
| Gene Symbol | ZC3H12D |
| Gene ID (NCBI) | 340152 |
| RRID | AB_2879834 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | A2A288 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ZC3H12D, also named as MCP induced protein 4, is a 527 amino acid protein, which contains one C3H1-type zinc finger and belongs to the ZC3H12 family. ZC3H12D exists as three isoforms and localizes in the cytoplasm. ZC3H12D may regulate cell growth likely by suppressing RB1 phosphorylation and serves as a tumor suppressor in certain leukemia cells. ZC3H12D is expressed in normal human lymphocytes but defective in some leukemia/lymphoma cell lines.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ZC3H12D antibody 24991-1-AP | Download protocol |
| IP protocol for ZC3H12D antibody 24991-1-AP | Download protocol |
| WB protocol for ZC3H12D antibody 24991-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ZC3H12D antibody (Cat# 24991-1-AP) has 7 citations published in Nature Communications, Cell Reports Medicine, Frontiers in Aging Neuroscience, Computational and Structural Biotechnology Journal, Journal of Biological Chemistry, Oncology Letters, and Translational Cancer Research. Research fields span extracellular mRNA nuclear transport, biliary tract cancer organoids, leukoaraiosis/inflammation, MALT1 substrate prediction, IL-6 mRNA degradation, osteosarcoma, and lung adenocarcinoma biomarkers.
| Species | Application | Title |
|---|---|---|
Nat Commun Extracellular mRNA transported to the nucleus exerts translation-independent function.
| ||
Cell Rep Med Personalized drug screening in patient-derived organoids of biliary tract cancer and its clinical application | ||
Front Aging Neurosci DNA Methylation Profiling Reveals the Change of Inflammation-Associated ZC3H12D in Leukoaraiosis. | ||
Comput Struct Biotechnol J Integrating knowledge of protein sequence with protein function for the prediction and validation of new MALT1 substrates | ||
J Biol Chem Monocyte Chemotactic Protein-induced Protein 1 and 4 Form a Complex but Act Independently in Regulation of Interleukin-6 mRNA Degradation.
| ||
Transl Cancer Res ZC3H12D is a prognostic biomarker associated with immune cell infiltration in lung adenocarcinoma. |
Reviews
What customers say
One reviewer (Elaine Wong) gave a 5-star rating after using the antibody at 1:1000 in 5% BSA+TBS-T for Western Blot on murine T cells. She reported a single clear band at the expected size with no apparent cross-reactivity to Zc3h12a, describing the performance as very good overall.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Elaine (Verified Customer) (09-06-2024) | Worked very nicely in western blot. Showed one clear band of the correct size in mouse T cell lysate and appears to not have cross-reactivity with Zc3h12a.
|













