ZC3H14 Polyclonal antibody

• 

  WB analysis of mouse brain using 28190-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 28190-1-AP (ZC3H14 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HEK-293T using 28190-1-AP

  IP result of anti-ZC3H14 (IP:28190-1-AP, 4ug; Detection:28190-1-AP 1:4000) with HEK-293T cells lysate 2200 ug.

ZC3H14 Polyclonal Antibody for WB, IP, ELISA

Cat No. 28190-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, ELISA

Synonyms

UKp68, NY REN 37

---

Tested Applications

• Positive WB detected in: mouse brain tissue
• Positive IP detected in: HEK-293T cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28190-1-AP targets ZC3H14 in WB, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28182

  Product name: Recombinant human ZC3H14 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 120-369 aa of NM_001160103

  Sequence: MPSARPEKRDSRVSTSSQESKTTNVRQTYDDGAATRLMSTVKPLREPAPSEDVIDIKPEPDDLIDEDLNFVQENPLSQKKPTVTLTYGSSRPSIEIYRPPASRNADSGVHLNRLQFQQQQNSIHAAKQLDMQSSWVYETGRLCEPEVLNSLEETYSPFFRNNSEKMSMEDENFRKRKLPVVSSVVKVKKFNHDGEEEEEDDDYGSRTGSISSSVSVPAKPERRPSLPPSKQANKNLILKAISEAQESVTKT

• Full Name: zinc finger CCCH-type containing 14
• Calculated Molecular Weight: 83 aa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: NM_001160103
• Gene Symbol: ZC3H14
• Gene ID (NCBI): 79882
• RRID: AB_2881085
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6PJT7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.