ZC3H7A Polyclonal antibody

• 

  WB analysis using 34174-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 34174-1-AP (ZC3H7A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of A431 using 34174-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using ZC3H7A antibody (34174-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

ZC3H7A Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 34174-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

HSPC055, ZC3H7, ZC3HDC7, Zinc finger CCCH domain-containing protein 7A, Zinc Finger CCCH-Type Containing 7A

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, L02 cells, MCF-7 cells
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

34174-1-AP targets ZC3H7A in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag40239

  Product name: Recombinant human ZC3H7A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-205 aa of NM_014153.3

  Sequence: MSNVSEERRKRQQNIKEGLQFIQSPLSYPGTQEQYAVYLRALVRNLFNEGNDVYREHDWNNSISQYTEALNIADYAKSEEILIPKEIIEKLYINRIACYSNMGFHDKVLEDCNIVLSLNASNCKALYRKSKALSDLGRYKKAYDAVAKCSLAVPQDEHVIKLTQELAQKLGFKIRKAYVRAELSLKSVPGDGATKALNHSVEDIE

• Full Name: zinc finger CCCH-type containing 7A
• Calculated Molecular Weight: 110kDa，971aa
• Observed Molecular Weight: 110 kDa
• GenBank Accession Number: NM_014153.3
• Gene Symbol: ZC3H7A
• Gene ID (NCBI): 29066
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8IWR0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZC3H7A (Zinc finger CCCH-type containing 7A, also known as HSPC055 or FLJ20318) is an RNA-binding protein containing zinc finger domains. This protein contains one C2H2-type zinc finger, three CCCH-type zinc fingers, and three TPR repeat sequences, belonging to the class III CCCH zinc finger protein family. ZC3H7A primarily functions in miRNA binding, where it recognizes miRNA hairpin sequences and participates in regulating miRNA biogenesis and processing. Research indicates that this protein plays a significant role in immune regulation: its expression is significantly upregulated upon macrophage activation, Th2 cell activation, and LPS stimulation, and it is enriched in immune organs such as the thymus and spleen. Notably, HIV vaccine studies have found that high expression of ZC3H7A is associated with decreased vaccine protective efficacy. Furthermore, genome-wide association studies suggest its correlation with QT interval duration, though the specific molecular mechanisms require further investigation.