Use Able AI chat for product recommendations

ZC3H7A Polyclonal antibody, PBS Only

ZC3H7A Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 34174-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

HSPC055, ZC3H7, ZC3HDC7, Zinc finger CCCH domain-containing protein 7A, Zinc Finger CCCH-Type Containing 7A

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

34174-1-PBS targets ZC3H7A in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag40239

Product name: Recombinant human ZC3H7A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-205 aa of NM_014153.3

Sequence: MSNVSEERRKRQQNIKEGLQFIQSPLSYPGTQEQYAVYLRALVRNLFNEGNDVYREHDWNNSISQYTEALNIADYAKSEEILIPKEIIEKLYINRIACYSNMGFHDKVLEDCNIVLSLNASNCKALYRKSKALSDLGRYKKAYDAVAKCSLAVPQDEHVIKLTQELAQKLGFKIRKAYVRAELSLKSVPGDGATKALNHSVEDIE

Predict reactive species
Full Name zinc finger CCCH-type containing 7A
Calculated Molecular Weight110kDa,971aa
Observed Molecular Weight110 kDa
GenBank Accession NumberNM_014153.3
Gene Symbol ZC3H7A
Gene ID (NCBI) 29066
RRIDAB_3743165
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDQ8IWR0
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ZC3H7A (Zinc finger CCCH-type containing 7A, also known as HSPC055 or FLJ20318) is an RNA-binding protein containing zinc finger domains. This protein contains one C2H2-type zinc finger, three CCCH-type zinc fingers, and three TPR repeat sequences, belonging to the class III CCCH zinc finger protein family. ZC3H7A primarily functions in miRNA binding, where it recognizes miRNA hairpin sequences and participates in regulating miRNA biogenesis and processing. Research indicates that this protein plays a significant role in immune regulation: its expression is significantly upregulated upon macrophage activation, Th2 cell activation, and LPS stimulation, and it is enriched in immune organs such as the thymus and spleen. Notably, HIV vaccine studies have found that high expression of ZC3H7A is associated with decreased vaccine protective efficacy. Furthermore, genome-wide association studies suggest its correlation with QT interval duration, though the specific molecular mechanisms require further investigation.

Loading...
||
New chat

Able

正在加载,请稍候...