ZCCHC24 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZCCHC24 Polyclonal antibody, PBS Only (33741-1-PBS)

• 

  WB analysis using 33741-1-AP (same clone as 33741-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33741-1-AP (ZCCHC24 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33741-1-PBS in a different storage buffer formulation.

ZCCHC24 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33741-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

C10orf56, Zinc finger CCHC domain-containing protein 24

---

Product Information

33741-1-PBS targets ZCCHC24 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag39605

  Product name: Recombinant human ZCCHC24 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-241 aa of NM_153367.4

  Sequence: MSLLSAIDTSAASVYQPAQLLNWVYLSLQDTHQASAFDAFRPEPTAGAAPPELAFGKGRPEQLGSPLHSSYLNSFFQLQRGEALSNSVYKGASPYGSLNNIADGLSSLTEHFSDLTLTSEARKPSKRPPPNYLCHLCFNKGHYIKDCPQARPKGEGLTPYQGKKRCFGEYKCPKCKRKWMSGNSWANMGQECIKCHINVYPHKQRPLEKPDGLDVSDQSKEHPQHLCEKCKVLGYYCRRVQ*

• Full Name: zinc finger, CCHC domain containing 24
• Calculated Molecular Weight: 27kDa，241aa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: NM_153367.4
• Gene Symbol: ZCCHC24
• Gene ID (NCBI): 219654
• RRID: AB_3743065
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8N2G6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.