ZCCHC6 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• ZCCHC6 Recombinant monoclonal antibody, PBS Only (88391-1-PBS)

ZCCHC6 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 88391-1-PBS

Clone No.260850G10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

EC:2.7.7.52, HS2, KIAA1711, PAPD6, Terminal uridylyltransferase 7

• 

  WB analysis using 88391-1-RR (same clone as 88391-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 88391-1-RR (ZCCHC6 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88391-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

88391-1-PBS targets ZCCHC6 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag18240

  Product name: Recombinant human ZCCHC6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-251 aa of BC032456

  Sequence: MGDTAKPYFVKRTKDRGTMDDDDFRRGHPQQDYLIIDDHAKGHGSKMEKGLQKKKITPGNYGNTPRKGPCAVSSNPYAFKNPIYSQPAWMNDSHKDQSKRWLSDEHTGNSDNWREFKPGPRIPVINRQRKDSFQENEDGYRWQDTRGCRTVRRLFHKDLTSLETTSEMEAGSPENKKQRSRPRKPRKTRNEENEQDGDLEGPVIDESVLSTKELLGLQQAEERLKRDCIDRLKRRPRNYPTAKYTCRLCDV

• Full Name: zinc finger, CCHC domain containing 6
• Calculated Molecular Weight: 1495 aa, 171 kDa
• Observed Molecular Weight: 171 kDa
• GenBank Accession Number: BC032456
• Gene Symbol: ZCCHC6
• Gene ID (NCBI): 79670
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q5VYS8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZCCHC6 also named as KIAA1711 ,HS2 or TUT7 is a 1495 amino acid protein, which contains threes CCHC-type zinc fingers and two PAP-associated domains. A member of the DNA polymerase type-B-like family, ZCCHC6 as a uridylyltransferase that mediates RNA uridylation.