Tested Applications
| Positive WB detected in | HeLa cells, Jurkat cells, U-251 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
32904-1-AP targets ZCWPW2 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag36666 Product name: Recombinant human ZCWPW2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 250-356 aa of BC094696 Sequence: VYSDDALSKENRVVCETEVLLKELEQMLQQALQPTATPDESEEGHGEEINMGEKLSKCSPEAPAGSLFENHYEEDYLVIDGIKLKAGECIEDITNKFKEIDALMSEF Predict reactive species |
| Full Name | zinc finger, CW type with PWWP domain 2 |
| Observed Molecular Weight | 47 kDa |
| GenBank Accession Number | BC094696 |
| Gene Symbol | ZCWPW2 |
| Gene ID (NCBI) | 152098 |
| RRID | AB_3742783 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q504Y3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ZCWPW2 (Zinc Finger CW-type and PWWP Domain Containing 2) is a protein containing CW-type zinc finger and PWWP domains. It mainly serves as a histone methylation "reader" protein that binds lysine 4 (H3K4me0, H3K4me1, H3K4me3) in different methylation states on histone H3, and is involved in the regulation of chromatin structure and gene expression. In addition, ZCWPW2 protein plays an important role in meiosis and germ cell development, and its function is closely related to PRDM9 protein, which may be a key interacting protein in the mechanism of double-strand break repair or recombination.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for ZCWPW2 antibody 32904-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

