ZCWPW2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ZCWPW2 Polyclonal antibody (32904-1-AP)

• 

  WB analysis using 32904-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32904-1-AP (ZCWPW2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

ZCWPW2 Polyclonal Antibody for WB, ELISA

Cat No. 32904-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Zinc Finger CW-Type And PWWP Domain 2, Zinc Finger CW-Type And PWWP Domain Containing 2 , Zinc finger CW-type PWWP domain protein 2, Zinc Finger, CW Type With PWWP Domain 2

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells, U-251 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32904-1-AP targets ZCWPW2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36666

  Product name: Recombinant human ZCWPW2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 250-356 aa of BC094696

  Sequence: VYSDDALSKENRVVCETEVLLKELEQMLQQALQPTATPDESEEGHGEEINMGEKLSKCSPEAPAGSLFENHYEEDYLVIDGIKLKAGECIEDITNKFKEIDALMSEF

• Full Name: zinc finger, CW type with PWWP domain 2
• Observed Molecular Weight: 47 kDa
• GenBank Accession Number: BC094696
• Gene Symbol: ZCWPW2
• Gene ID (NCBI): 152098
• RRID: AB_3742783
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q504Y3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZCWPW2 (Zinc Finger CW-type and PWWP Domain Containing 2) is a protein containing CW-type zinc finger and PWWP domains. It mainly serves as a histone methylation "reader" protein that binds lysine 4 (H3K4me0, H3K4me1, H3K4me3) in different methylation states on histone H3, and is involved in the regulation of chromatin structure and gene expression. In addition, ZCWPW2 protein plays an important role in meiosis and germ cell development, and its function is closely related to PRDM9 protein, which may be a key interacting protein in the mechanism of double-strand break repair or recombination.