ZDHHC12 Polyclonal antibody

• 

  IHC staining of human kidney using 26433-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 26433-1-AP (ZDHHC12 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 26433-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 26433-1-AP (ZDHHC12 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human thyroid cancer using 26433-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 26433-1-AP (ZDHHC12 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human thyroid cancer using 26433-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 26433-1-AP (ZDHHC12 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

ZDHHC12 Polyclonal Antibody for IHC, ELISA

Cat No. 26433-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IP, ELISA

Synonyms

DHHC 12, DHHC domain-containing cysteine-rich protein 12, DHHC-12, EC:2.3.1.225, Palmitoyltransferase ZDHHC12

---

Tested Applications

• Positive IHC detected in: human kidney tissue, human thyroid cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IP: See 1 publications below

Product Information

26433-1-AP targets ZDHHC12 in IHC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23634

  Product name: Recombinant human ZDHHC12 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-322 aa of BC048251

  Sequence: MAPWALLSPGVLVRTGHTVLTWGITLVLFLHDTDKSADELLATHSHSWNQHLQAFAQPGTHFPTSNCTPTPPTPVLPGPASLCSPASPELRQWEEQGELLLPLTFLLLVLGSLLLYLAVSLMDPGYVNVQPQPQEELKEEQTAMVPPAIPLRRCRYCLVLQPLRARHCRECRRCVRRYDHHCPWMENCVGERNHPLFVVYLALQLVVLLWGLYLAWSGLRFFQPWGLWLRSSGLLFATFLLLSLFSLVASLLLVSHLYLVASNTTTWEFISSHRIAYLRQRPSNPFDRGLTRNLAHFFCGWPSGSWETLWAEEEEEGSSPAV

• Full Name: zinc finger, DHHC-type containing 12
• Observed Molecular Weight: 29 kDa, 32 kDa
• GenBank Accession Number: BC048251
• Gene Symbol: ZDHHC12
• Gene ID (NCBI): 84885
• RRID: AB_2880512
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96GR4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IP	Autophagy; ABHD8 antagonizes inflammation by facilitating chaperone-mediated autophagy-mediated degradation of NLRP3; Authors - Shuai Yang