Product Information
26658-1-AP targets ZDHHC23 in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24557 Product name: Recombinant human ZDHHC23 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-83 aa of BC035230 Sequence: MTQKGSMKPVKKKKTEEPELEPLCCCEYIDRNGEKNHVATCLCDCQDLDEGCDRWITCKSLQPETCERIMDTISDRLRIPWLR Predict reactive species |
| Full Name | zinc finger, DHHC-type containing 23 |
| GenBank Accession Number | BC035230 |
| Gene Symbol | ZDHHC23 |
| Gene ID (NCBI) | 254887 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8IYP9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Publications
What published studies show
The ZDHHC23 Polyclonal antibody (Cat# 26658-1-AP) has a total of 1 citation. It was published in Communications Biology (2025), in a study investigating how zingerone treats postmenopausal osteoporosis through p53-mediated regulation of SAT1 and GPX4 expression, increasing ferroptosis sensitivity. The antibody was applied in WB and IHC using mouse samples. The associated research field encompasses bone biology, ferroptosis, and postmenopausal osteoporosis.
| Species | Application | Title |
|---|---|---|
Commun Biol Zingerone treats postmenopausal osteoporosis via increased ferroptosis sensitivity by p53-mediated regulation of SAT1 and GPX4 expression. |
