Product Information
26658-1-AP targets ZDHHC23 in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24557 Product name: Recombinant human ZDHHC23 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-83 aa of BC035230 Sequence: MTQKGSMKPVKKKKTEEPELEPLCCCEYIDRNGEKNHVATCLCDCQDLDEGCDRWITCKSLQPETCERIMDTISDRLRIPWLR Predict reactive species |
| Full Name | zinc finger, DHHC-type containing 23 |
| GenBank Accession Number | BC035230 |
| Gene Symbol | ZDHHC23 |
| Gene ID (NCBI) | 254887 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8IYP9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
