ZDHHC8 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• ZDHHC8 Recombinant monoclonal antibody, PBS Only (86572-2-PBS)

• 

  WB analysis of HeLa using 86572-2-RR (same clone as 86572-2-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 86572-2-RR (ZDHHC8 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86572-2-PBS in a different storage buffer formulation.

• 

  WB analysis using 86572-2-RR (same clone as 86572-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86572-2-RR (ZDHHC8 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86572-2-PBS in a different storage buffer formulation.

• 

  Affinity of 86572-2-RR

  Biolayer interferometry (BLl) kinetic assays of 86572-2-RR against Human ZDHHC8 were performed. The affinity constant is 0.915 nM.

ZDHHC8 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86572-2-PBS

Clone No.251438A7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

DHHC 8, DHHC8, DHHC-8, EC:2.3.1.225, KIAA1292

---

Product Information

86572-2-PBS targets ZDHHC8 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag26028

  Product name: Recombinant human ZDHHC8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 274-430 aa of BC053544

  Sequence: LLDRAAPLKVKLSDNGLKAGLGRSKSKGSLDRLDEKPLDLGPPLPPKIEAGTFSSDLQTPRPGSAESALSVQRTSPPTPAMYKFRPAFPTGPKVPFCGPGEQVPGPDSLTLGDDSIRSLDFVSEPSLDLPDYGPGGLHAAYPPSPPLSASDAFSGAL

• Full Name: zinc finger, DHHC-type containing 8
• Calculated Molecular Weight: 83 kDa
• Observed Molecular Weight: 70-85 kDa
• GenBank Accession Number: BC053544
• Gene Symbol: ZDHHC8
• Gene ID (NCBI): 29801
• RRID: AB_3744974
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9ULC8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Zinc finger DHHC-type containing 8 (ZDHHC8), a putative palmitoyltransferase that contains a conserved cysteine-rich signature catalytic (DHHC) domain, is highly expressed in the brain. (PMID: 38211651, PMID: 30038264, PMID: 16225675)